Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JUJ8

Protein Details
Accession I2JUJ8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GKNYVLQKNHFKKHWQRRVRVHLDQAGHydrophilic
NLS Segment(s)
PositionSequence
170-197LARSKKRYLGIREKRAAERAAAEAEKKK
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MAIGKNYVLQKNHFKKHWQRRVRVHLDQAGQKLSRRNARAAKAAAVAPKPVDLLRPVVRCPTLKYNRKVRAGKGFTFAELKAAKLDPKYAQTVGIAVDHRRVNKSTETFDANVERLELYKKSLIVFKKGEKPTAEQVSAAAAFPIVQSAPETAPRAVEVPERTAYRTLRLARSKKRYLGIREKRAAERAAAEAEKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.78
4 0.82
5 0.82
6 0.82
7 0.84
8 0.91
9 0.9
10 0.86
11 0.83
12 0.79
13 0.74
14 0.7
15 0.62
16 0.57
17 0.49
18 0.45
19 0.43
20 0.43
21 0.46
22 0.44
23 0.49
24 0.51
25 0.54
26 0.58
27 0.54
28 0.49
29 0.44
30 0.43
31 0.39
32 0.32
33 0.28
34 0.21
35 0.2
36 0.18
37 0.15
38 0.15
39 0.12
40 0.16
41 0.21
42 0.23
43 0.24
44 0.26
45 0.29
46 0.28
47 0.32
48 0.37
49 0.41
50 0.48
51 0.54
52 0.61
53 0.66
54 0.74
55 0.74
56 0.68
57 0.69
58 0.65
59 0.6
60 0.55
61 0.47
62 0.39
63 0.37
64 0.31
65 0.26
66 0.2
67 0.19
68 0.15
69 0.15
70 0.16
71 0.14
72 0.17
73 0.13
74 0.16
75 0.18
76 0.16
77 0.16
78 0.15
79 0.15
80 0.12
81 0.13
82 0.11
83 0.09
84 0.13
85 0.14
86 0.15
87 0.16
88 0.17
89 0.17
90 0.21
91 0.23
92 0.22
93 0.22
94 0.25
95 0.24
96 0.24
97 0.23
98 0.19
99 0.16
100 0.14
101 0.12
102 0.09
103 0.11
104 0.09
105 0.1
106 0.11
107 0.12
108 0.13
109 0.18
110 0.19
111 0.23
112 0.27
113 0.29
114 0.37
115 0.39
116 0.42
117 0.39
118 0.42
119 0.44
120 0.45
121 0.4
122 0.31
123 0.29
124 0.27
125 0.25
126 0.21
127 0.13
128 0.07
129 0.06
130 0.06
131 0.07
132 0.04
133 0.04
134 0.05
135 0.07
136 0.08
137 0.12
138 0.15
139 0.14
140 0.15
141 0.15
142 0.16
143 0.15
144 0.2
145 0.18
146 0.19
147 0.24
148 0.24
149 0.26
150 0.3
151 0.3
152 0.29
153 0.34
154 0.35
155 0.4
156 0.49
157 0.56
158 0.61
159 0.7
160 0.74
161 0.73
162 0.75
163 0.75
164 0.75
165 0.77
166 0.78
167 0.79
168 0.78
169 0.78
170 0.75
171 0.72
172 0.64
173 0.55
174 0.48
175 0.4
176 0.39
177 0.35