Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8E920

Protein Details
Accession A0A1B8E920    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-35LPMMGYQKYRKHKARKAMKKELGAHydrophilic
NLS Segment(s)
PositionSequence
21-31RKHKARKAMKK
Subcellular Location(s) mito 13, extr 11, plas 2
Family & Domain DBs
Amino Acid Sequences MAAVVLMAIVVLPMMGYQKYRKHKARKAMKKELGAQPEPLQGGHQAVREQTGDHPPSYDDTVGSHPSPPYTANGPPGYLQRPSSNRGLPVGHLPNSYLSPTAVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.08
4 0.13
5 0.22
6 0.31
7 0.41
8 0.5
9 0.6
10 0.67
11 0.75
12 0.81
13 0.84
14 0.85
15 0.87
16 0.85
17 0.79
18 0.8
19 0.76
20 0.72
21 0.62
22 0.54
23 0.45
24 0.4
25 0.35
26 0.27
27 0.21
28 0.14
29 0.14
30 0.14
31 0.13
32 0.11
33 0.11
34 0.12
35 0.12
36 0.12
37 0.12
38 0.17
39 0.17
40 0.16
41 0.17
42 0.16
43 0.17
44 0.18
45 0.16
46 0.09
47 0.1
48 0.12
49 0.14
50 0.15
51 0.14
52 0.13
53 0.13
54 0.14
55 0.13
56 0.13
57 0.14
58 0.16
59 0.2
60 0.2
61 0.21
62 0.22
63 0.24
64 0.25
65 0.24
66 0.24
67 0.26
68 0.29
69 0.32
70 0.37
71 0.36
72 0.35
73 0.36
74 0.35
75 0.3
76 0.35
77 0.37
78 0.33
79 0.3
80 0.3
81 0.29
82 0.29
83 0.29
84 0.21
85 0.16