Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JQW0

Protein Details
Accession I2JQW0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-94VASWVKYFKQKRPFDKKKAKILKQAKDEGAHydrophilic
NLS Segment(s)
PositionSequence
76-86KRPFDKKKAKI
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
Pfam View protein in Pfam  
PF02297  COX6B  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGLFFADXKSGEAPNRKSREQCWESRDIFFKCLDNIKVIDPLDPEKGQEIKKNCGKEDQQFQKDCVASWVKYFKQKRPFDKKKAKILKQAKDEGAEVIQMSGYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.52
4 0.5
5 0.54
6 0.57
7 0.58
8 0.55
9 0.57
10 0.55
11 0.55
12 0.57
13 0.48
14 0.44
15 0.38
16 0.33
17 0.27
18 0.29
19 0.26
20 0.22
21 0.21
22 0.2
23 0.23
24 0.22
25 0.2
26 0.17
27 0.18
28 0.19
29 0.18
30 0.17
31 0.15
32 0.19
33 0.19
34 0.23
35 0.24
36 0.28
37 0.32
38 0.34
39 0.32
40 0.35
41 0.36
42 0.37
43 0.44
44 0.46
45 0.49
46 0.47
47 0.48
48 0.47
49 0.44
50 0.38
51 0.33
52 0.27
53 0.2
54 0.23
55 0.28
56 0.25
57 0.34
58 0.39
59 0.42
60 0.49
61 0.57
62 0.65
63 0.7
64 0.78
65 0.8
66 0.87
67 0.87
68 0.88
69 0.91
70 0.88
71 0.87
72 0.87
73 0.85
74 0.82
75 0.81
76 0.73
77 0.65
78 0.58
79 0.49
80 0.4
81 0.32
82 0.23
83 0.16
84 0.13