Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A5ZZ12

Protein Details
Accession A0A1A5ZZ12    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
312-343KEVFVEHATKRQKKKLWRKKDGPKFEYPWKESBasic
NLS Segment(s)
PositionSequence
321-335KRQKKKLWRKKDGPK
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MSLLASSARIAPRSLKAVRALSTSSSPFAAAASASSSAPPSTPTSRYVRKTAVPSRSATSASSSSSARPSTSVPRSTTARQVTPTPSPTPAPASASTSYDDFPFPDEAPLSTLISEPIIEDYAHLAEPSTASPPLTSLPGEGYSPLPSASSSASGSIEGEAKVGDGEGGQDWSNSFAGLSEKPFPKEVADELLRELRPQDVEIKPDGLLYLPEIKYRRTLNAAFGPGGWGLAPRGETNVGPRIVSREWGLVCLGRLVSIARGEQEYFDPSGIPTATEACKSNALMRCCKDLGIASELWDPSFIRDFKHKHCKEVFVEHATKRQKKKLWRKKDGPKFEYPWKESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.38
4 0.41
5 0.42
6 0.41
7 0.38
8 0.34
9 0.37
10 0.34
11 0.29
12 0.25
13 0.23
14 0.19
15 0.17
16 0.14
17 0.1
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.1
25 0.11
26 0.13
27 0.16
28 0.2
29 0.22
30 0.27
31 0.34
32 0.42
33 0.47
34 0.5
35 0.5
36 0.51
37 0.58
38 0.62
39 0.63
40 0.57
41 0.56
42 0.53
43 0.5
44 0.46
45 0.37
46 0.33
47 0.26
48 0.24
49 0.23
50 0.21
51 0.2
52 0.23
53 0.23
54 0.19
55 0.19
56 0.21
57 0.28
58 0.34
59 0.37
60 0.36
61 0.39
62 0.43
63 0.45
64 0.5
65 0.46
66 0.42
67 0.39
68 0.4
69 0.41
70 0.42
71 0.43
72 0.37
73 0.34
74 0.32
75 0.32
76 0.32
77 0.29
78 0.27
79 0.24
80 0.26
81 0.25
82 0.25
83 0.24
84 0.21
85 0.2
86 0.17
87 0.16
88 0.12
89 0.13
90 0.13
91 0.12
92 0.13
93 0.12
94 0.12
95 0.13
96 0.14
97 0.12
98 0.1
99 0.1
100 0.09
101 0.09
102 0.08
103 0.07
104 0.06
105 0.07
106 0.06
107 0.06
108 0.07
109 0.08
110 0.08
111 0.07
112 0.07
113 0.06
114 0.07
115 0.07
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.09
122 0.09
123 0.09
124 0.07
125 0.08
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.08
136 0.08
137 0.08
138 0.07
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.05
156 0.04
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.07
165 0.07
166 0.09
167 0.13
168 0.15
169 0.16
170 0.17
171 0.17
172 0.16
173 0.17
174 0.16
175 0.16
176 0.16
177 0.15
178 0.16
179 0.2
180 0.19
181 0.17
182 0.17
183 0.13
184 0.12
185 0.13
186 0.18
187 0.15
188 0.17
189 0.18
190 0.19
191 0.17
192 0.17
193 0.16
194 0.1
195 0.09
196 0.08
197 0.13
198 0.12
199 0.16
200 0.17
201 0.18
202 0.22
203 0.24
204 0.25
205 0.24
206 0.25
207 0.27
208 0.31
209 0.32
210 0.28
211 0.26
212 0.25
213 0.19
214 0.18
215 0.12
216 0.07
217 0.06
218 0.06
219 0.07
220 0.06
221 0.08
222 0.09
223 0.1
224 0.13
225 0.19
226 0.18
227 0.17
228 0.17
229 0.2
230 0.2
231 0.21
232 0.19
233 0.17
234 0.17
235 0.18
236 0.18
237 0.15
238 0.14
239 0.14
240 0.13
241 0.09
242 0.09
243 0.08
244 0.09
245 0.1
246 0.1
247 0.1
248 0.12
249 0.12
250 0.13
251 0.14
252 0.15
253 0.14
254 0.14
255 0.13
256 0.11
257 0.14
258 0.12
259 0.11
260 0.09
261 0.12
262 0.13
263 0.15
264 0.16
265 0.16
266 0.18
267 0.19
268 0.26
269 0.29
270 0.32
271 0.38
272 0.39
273 0.42
274 0.4
275 0.4
276 0.34
277 0.31
278 0.3
279 0.26
280 0.24
281 0.21
282 0.24
283 0.24
284 0.23
285 0.21
286 0.17
287 0.16
288 0.23
289 0.21
290 0.2
291 0.29
292 0.35
293 0.44
294 0.55
295 0.54
296 0.56
297 0.61
298 0.66
299 0.63
300 0.66
301 0.63
302 0.61
303 0.66
304 0.59
305 0.63
306 0.65
307 0.68
308 0.67
309 0.69
310 0.69
311 0.73
312 0.82
313 0.84
314 0.85
315 0.88
316 0.9
317 0.92
318 0.95
319 0.95
320 0.91
321 0.9
322 0.85
323 0.84
324 0.84