Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JXN1

Protein Details
Accession I2JXN1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-28KLTNTALRRIRHKPRRKPVDDISFEHydrophilic
NLS Segment(s)
PositionSequence
11-20RRIRHKPRRK
Subcellular Location(s) nucl 23, mito_nucl 13.833, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045293  Complex1_LYR_LYRM2  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20262  Complex1_LYR_LYRM2  
Amino Acid Sequences MSTKLTNTALRRIRHKPRRKPVDDISFEEFVLKNQILQSYRDMMRTLQKIPDESTREEVHDFVKGEFQSSRNVSNVETRRSLLIGGIRQFQSLANSLGISMPTIDFSSGRQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.79
4 0.83
5 0.89
6 0.87
7 0.86
8 0.84
9 0.84
10 0.79
11 0.73
12 0.67
13 0.56
14 0.51
15 0.44
16 0.34
17 0.23
18 0.22
19 0.17
20 0.12
21 0.12
22 0.17
23 0.16
24 0.18
25 0.2
26 0.21
27 0.22
28 0.22
29 0.22
30 0.19
31 0.25
32 0.25
33 0.25
34 0.23
35 0.23
36 0.23
37 0.25
38 0.3
39 0.27
40 0.26
41 0.28
42 0.25
43 0.25
44 0.24
45 0.22
46 0.17
47 0.16
48 0.15
49 0.11
50 0.15
51 0.13
52 0.15
53 0.15
54 0.16
55 0.18
56 0.19
57 0.21
58 0.18
59 0.19
60 0.18
61 0.26
62 0.29
63 0.28
64 0.28
65 0.27
66 0.27
67 0.26
68 0.25
69 0.19
70 0.19
71 0.19
72 0.2
73 0.24
74 0.23
75 0.23
76 0.23
77 0.22
78 0.2
79 0.18
80 0.18
81 0.13
82 0.13
83 0.13
84 0.14
85 0.13
86 0.11
87 0.09
88 0.07
89 0.08
90 0.09
91 0.1
92 0.09