Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A5ZVK5

Protein Details
Accession A0A1A5ZVK5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-106PLDLRYKKTRAIRRRLTHKEANAHydrophilic
NLS Segment(s)
PositionSequence
91-102KTRAIRRRLTHK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MASSSSKIRAFELQSKSKQDLSTQLNELKTELASLRVQKIAGGSASKLTKINTVRKSIARVLTVINHKQRDNLREFYNKSKYLPLDLRYKKTRAIRRRLTHKEANAITEKQHKRNIHFPARKFALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.57
4 0.55
5 0.5
6 0.44
7 0.44
8 0.42
9 0.41
10 0.4
11 0.42
12 0.38
13 0.38
14 0.35
15 0.28
16 0.22
17 0.17
18 0.13
19 0.12
20 0.13
21 0.15
22 0.17
23 0.17
24 0.17
25 0.16
26 0.17
27 0.15
28 0.13
29 0.12
30 0.1
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.18
37 0.23
38 0.31
39 0.32
40 0.36
41 0.38
42 0.39
43 0.42
44 0.41
45 0.38
46 0.3
47 0.26
48 0.23
49 0.24
50 0.27
51 0.28
52 0.29
53 0.28
54 0.28
55 0.32
56 0.35
57 0.36
58 0.37
59 0.35
60 0.34
61 0.39
62 0.42
63 0.45
64 0.48
65 0.44
66 0.4
67 0.42
68 0.38
69 0.37
70 0.39
71 0.35
72 0.38
73 0.42
74 0.48
75 0.48
76 0.49
77 0.5
78 0.54
79 0.6
80 0.6
81 0.65
82 0.69
83 0.73
84 0.82
85 0.85
86 0.84
87 0.82
88 0.77
89 0.75
90 0.66
91 0.62
92 0.56
93 0.48
94 0.44
95 0.46
96 0.48
97 0.45
98 0.52
99 0.53
100 0.53
101 0.61
102 0.67
103 0.68
104 0.7
105 0.68
106 0.7
107 0.71