Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A390

Protein Details
Accession A0A1A6A390    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-62SSRGIDGTTKKRRRRGRGSGAGGGCBasic
NLS Segment(s)
PositionSequence
47-55KKRRRRGRG
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTLIDLFQKLKHGSAYPLGKKDTHNSQDALRLRGGCISSRGIDGTTKKRRRRGRGSGAGGGCGGGGCGGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.37
4 0.4
5 0.41
6 0.4
7 0.4
8 0.43
9 0.44
10 0.39
11 0.37
12 0.34
13 0.33
14 0.39
15 0.39
16 0.36
17 0.28
18 0.24
19 0.21
20 0.22
21 0.22
22 0.14
23 0.14
24 0.13
25 0.12
26 0.12
27 0.12
28 0.11
29 0.13
30 0.17
31 0.25
32 0.34
33 0.43
34 0.49
35 0.58
36 0.67
37 0.74
38 0.8
39 0.81
40 0.82
41 0.83
42 0.83
43 0.82
44 0.73
45 0.64
46 0.53
47 0.42
48 0.31
49 0.2
50 0.13
51 0.05
52 0.04