Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A367

Protein Details
Accession A0A1A6A367   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-72SGQVAKSQKKHSKNKQVSKKQKARSEKGKERAHydrophilic
78-101KLGNRVKEREEKKAKRQRAKKAWEBasic
NLS Segment(s)
PositionSequence
46-100KSQKKHSKNKQVSKKQKARSEKGKERAVELSEKLGNRVKEREEKKAKRQRAKKAW
Subcellular Location(s) nucl 17, cyto_nucl 11.333, mito_nucl 11.333, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAGPEEAGPSTGTGAGAGIVPVQPSKIAKNARLPATMINPSGQVAKSQKKHSKNKQVSKKQKARSEKGKERAVELSEKLGNRVKEREEKKAKRQRAKKAWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.06
8 0.06
9 0.06
10 0.07
11 0.09
12 0.11
13 0.17
14 0.21
15 0.25
16 0.34
17 0.4
18 0.41
19 0.41
20 0.4
21 0.36
22 0.36
23 0.34
24 0.26
25 0.21
26 0.18
27 0.17
28 0.17
29 0.15
30 0.13
31 0.16
32 0.22
33 0.27
34 0.35
35 0.42
36 0.5
37 0.6
38 0.67
39 0.74
40 0.77
41 0.82
42 0.84
43 0.88
44 0.89
45 0.9
46 0.89
47 0.86
48 0.85
49 0.84
50 0.82
51 0.82
52 0.82
53 0.8
54 0.8
55 0.78
56 0.7
57 0.64
58 0.59
59 0.51
60 0.44
61 0.35
62 0.31
63 0.28
64 0.28
65 0.28
66 0.29
67 0.29
68 0.29
69 0.33
70 0.35
71 0.41
72 0.45
73 0.53
74 0.59
75 0.65
76 0.72
77 0.79
78 0.83
79 0.84
80 0.89
81 0.89