FuNGI

A0A1A6AGV3

Protein Details

Accession

A0A1A6AGV3

Localization Confidence

Low

Confidence Score

9.5

NoLS Segment(s)

Position	Sequence	Protein Nature
430-449	SFGKVFRKGKAKKSFKQEDI	Hydrophilic

NLS Segment(s)

Position	Sequence
437-442	KGKAKK

Subcellular Location(s)

cyto 15.5, cyto_nucl 12, nucl 5.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR043129 ATPase_NBD IPR004567 Type_II_PanK
Gene Ontology	GO:0005524 F:ATP binding GO:0004594 F:pantothenate kinase activity GO:0015937 P:coenzyme A biosynthetic process GO:0016310 P:phosphorylation
Pfam	View protein in Pfam PF03630 Fumble

Amino Acid Sequences

MPATSPMPDISIPQARRIVVDTTGAQIVQEESPATRDSRGIYLPHYIEPVSHIAIDIGGSLAKVVYFTRSNLPISTTPPQSGHSSPFLPPSESVFIPPFSSNGTSSSSSRHHESPSLNPHSHAPFDHSPPTRHPTLNGALTPGVLSEDYRNQASSASSAVRSYASTVSNHRGSFSKPHAGKYRRSDSLPPPLPGGLLNFARFETDNINDLIKFLQDLINRSAAVNRVSLEKMQKNVKVMATGGGAHMYYDLLRKELNVEVKREEEMECLILGLGFIARVPEEVFWFSEELVYKVSHTNTKDRPPEGEKLTIPPSELPRPSPTPPAYQVTFADANATDNVPNFPCLIVNIGSGVSIVKVDEDGSFERVSGTSLGGGTLWGLLSLLTDAENFDEMLLLSEQGDNSAVDMLVGDIYGSDYSKIGLKSSTIASSFGKVFRKGKAKKSFKQEDIARSLLYAISNNIGHVAYMNAAKYGLDKVFFGGCFIRGHAATISTLSYAIRFWSKGTMRACFLRHEGFLGAIGAWIKNVEPEPEPEIQSETSGGVDASLQRDVNGKAH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.35
3	0.36
4	0.37
5	0.33
6	0.26
7	0.29
8	0.24
9	0.22
10	0.23
11	0.21
12	0.18
13	0.16
14	0.16
15	0.13
16	0.13
17	0.11
18	0.1
19	0.13
20	0.15
21	0.15
22	0.15
23	0.16
24	0.18
25	0.21
26	0.24
27	0.24
28	0.24
29	0.3
30	0.31
31	0.31
32	0.3
33	0.26
34	0.23
35	0.24
36	0.25
37	0.19
38	0.17
39	0.15
40	0.13
41	0.13
42	0.13
43	0.1
44	0.07
45	0.05
46	0.05
47	0.05
48	0.05
49	0.04
50	0.05
51	0.06
52	0.1
53	0.12
54	0.14
55	0.2
56	0.23
57	0.25
58	0.25
59	0.3
60	0.28
61	0.32
62	0.36
63	0.33
64	0.32
65	0.32
66	0.34
67	0.34
68	0.34
69	0.32
70	0.3
71	0.3
72	0.29
73	0.34
74	0.33
75	0.31
76	0.29
77	0.3
78	0.3
79	0.28
80	0.29
81	0.24
82	0.23
83	0.24
84	0.23
85	0.18
86	0.17
87	0.19
88	0.17
89	0.17
90	0.2
91	0.2
92	0.21
93	0.25
94	0.26
95	0.28
96	0.31
97	0.32
98	0.31
99	0.34
100	0.36
101	0.4
102	0.46
103	0.5
104	0.47
105	0.45
106	0.46
107	0.44
108	0.43
109	0.34
110	0.32
111	0.29
112	0.32
113	0.4
114	0.39
115	0.39
116	0.43
117	0.48
118	0.45
119	0.41
120	0.38
121	0.36
122	0.38
123	0.39
124	0.34
125	0.3
126	0.25
127	0.25
128	0.23
129	0.16
130	0.12
131	0.08
132	0.08
133	0.09
134	0.13
135	0.15
136	0.15
137	0.16
138	0.15
139	0.16
140	0.16
141	0.14
142	0.12
143	0.12
144	0.12
145	0.11
146	0.12
147	0.11
148	0.11
149	0.13
150	0.13
151	0.13
152	0.15
153	0.18
154	0.23
155	0.27
156	0.27
157	0.26
158	0.25
159	0.25
160	0.31
161	0.32
162	0.36
163	0.33
164	0.4
165	0.48
166	0.51
167	0.56
168	0.58
169	0.61
170	0.55
171	0.57
172	0.57
173	0.54
174	0.6
175	0.57
176	0.49
177	0.43
178	0.39
179	0.36
180	0.3
181	0.25
182	0.18
183	0.14
184	0.14
185	0.13
186	0.13
187	0.14
188	0.14
189	0.13
190	0.12
191	0.12
192	0.13
193	0.13
194	0.14
195	0.13
196	0.13
197	0.12
198	0.09
199	0.07
200	0.07
201	0.1
202	0.11
203	0.14
204	0.16
205	0.17
206	0.17
207	0.17
208	0.18
209	0.16
210	0.16
211	0.14
212	0.12
213	0.13
214	0.13
215	0.16
216	0.2
217	0.21
218	0.24
219	0.28
220	0.3
221	0.3
222	0.32
223	0.3
224	0.25
225	0.23
226	0.2
227	0.15
228	0.14
229	0.11
230	0.09
231	0.08
232	0.07
233	0.06
234	0.05
235	0.05
236	0.07
237	0.07
238	0.07
239	0.07
240	0.07
241	0.09
242	0.12
243	0.2
244	0.2
245	0.22
246	0.23
247	0.24
248	0.24
249	0.23
250	0.21
251	0.13
252	0.11
253	0.1
254	0.08
255	0.07
256	0.07
257	0.05
258	0.04
259	0.04
260	0.03
261	0.02
262	0.02
263	0.02
264	0.02
265	0.03
266	0.04
267	0.04
268	0.05
269	0.06
270	0.06
271	0.07
272	0.07
273	0.07
274	0.08
275	0.08
276	0.08
277	0.09
278	0.08
279	0.09
280	0.1
281	0.12
282	0.14
283	0.16
284	0.23
285	0.26
286	0.34
287	0.38
288	0.37
289	0.4
290	0.4
291	0.44
292	0.4
293	0.39
294	0.32
295	0.31
296	0.33
297	0.29
298	0.25
299	0.22
300	0.23
301	0.24
302	0.25
303	0.24
304	0.25
305	0.29
306	0.3
307	0.35
308	0.33
309	0.32
310	0.34
311	0.36
312	0.32
313	0.3
314	0.28
315	0.25
316	0.24
317	0.19
318	0.18
319	0.13
320	0.14
321	0.13
322	0.13
323	0.09
324	0.09
325	0.1
326	0.09
327	0.1
328	0.09
329	0.08
330	0.08
331	0.08
332	0.09
333	0.08
334	0.08
335	0.08
336	0.07
337	0.07
338	0.07
339	0.07
340	0.05
341	0.04
342	0.04
343	0.03
344	0.04
345	0.04
346	0.05
347	0.07
348	0.08
349	0.11
350	0.11
351	0.11
352	0.11
353	0.1
354	0.11
355	0.09
356	0.08
357	0.07
358	0.07
359	0.07
360	0.06
361	0.06
362	0.05
363	0.05
364	0.04
365	0.03
366	0.03
367	0.03
368	0.03
369	0.04
370	0.04
371	0.04
372	0.04
373	0.04
374	0.05
375	0.05
376	0.05
377	0.05
378	0.05
379	0.05
380	0.07
381	0.07
382	0.06
383	0.06
384	0.07
385	0.07
386	0.07
387	0.08
388	0.06
389	0.06
390	0.07
391	0.06
392	0.05
393	0.05
394	0.05
395	0.04
396	0.04
397	0.03
398	0.03
399	0.04
400	0.04
401	0.05
402	0.05
403	0.05
404	0.06
405	0.1
406	0.1
407	0.1
408	0.11
409	0.11
410	0.13
411	0.15
412	0.17
413	0.14
414	0.16
415	0.16
416	0.19
417	0.2
418	0.22
419	0.25
420	0.27
421	0.29
422	0.35
423	0.44
424	0.48
425	0.57
426	0.63
427	0.69
428	0.71
429	0.79
430	0.82
431	0.76
432	0.78
433	0.75
434	0.72
435	0.68
436	0.62
437	0.51
438	0.41
439	0.38
440	0.29
441	0.23
442	0.16
443	0.11
444	0.12
445	0.12
446	0.12
447	0.13
448	0.11
449	0.11
450	0.1
451	0.1
452	0.08
453	0.1
454	0.1
455	0.09
456	0.09
457	0.09
458	0.1
459	0.13
460	0.13
461	0.12
462	0.12
463	0.14
464	0.17
465	0.17
466	0.18
467	0.15
468	0.16
469	0.16
470	0.17
471	0.18
472	0.15
473	0.17
474	0.16
475	0.16
476	0.15
477	0.15
478	0.15
479	0.11
480	0.12
481	0.1
482	0.09
483	0.08
484	0.11
485	0.13
486	0.13
487	0.14
488	0.22
489	0.25
490	0.31
491	0.35
492	0.37
493	0.38
494	0.43
495	0.44
496	0.39
497	0.42
498	0.39
499	0.36
500	0.33
501	0.3
502	0.25
503	0.24
504	0.2
505	0.15
506	0.12
507	0.12
508	0.1
509	0.09
510	0.09
511	0.08
512	0.11
513	0.12
514	0.14
515	0.15
516	0.19
517	0.24
518	0.27
519	0.29
520	0.27
521	0.29
522	0.26
523	0.25
524	0.22
525	0.18
526	0.15
527	0.13
528	0.12
529	0.08
530	0.1
531	0.11
532	0.13
533	0.15
534	0.15
535	0.15
536	0.2

A0A1A6AGV3

3D AlphaFold-predicted Structure Viewer