Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K119

Protein Details
Accession I2K119    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-151KGKIMRPHSSTNKQKARKKNFMMMVHydrophilic
153-182NRGVQGKKKMSLRQKQRVLRAHIKRQKRGYHydrophilic
NLS Segment(s)
PositionSequence
123-184REKFGSGKGKIMRPHSSTNKQKARKKNFMMMVHNRGVQGKKKMSLRQKQRVLRAHIKRQKRG
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027312  Sda1  
IPR007949  SDA1_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:0015031  P:protein transport  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0000055  P:ribosomal large subunit export from nucleus  
Pfam View protein in Pfam  
PF05285  SDA1  
Amino Acid Sequences MLKSKNRKKRELEDEDSDLELSDDXNDDDEXKSNPSKREKRVGDDKGNSEKKKALETLMSTVLTPADFEKLKELNEEAGXQKEMGLHRVNEDTIDSNDLVGYDKHKQTKEERLQSVMEGREGREKFGSGKGKIMRPHSSTNKQKARKKNFMMMVHNRGVQGKKKMSLRQKQRVLRAHIKRQKRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.67
3 0.59
4 0.48
5 0.37
6 0.27
7 0.2
8 0.13
9 0.1
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.11
16 0.15
17 0.17
18 0.23
19 0.27
20 0.36
21 0.44
22 0.49
23 0.58
24 0.59
25 0.64
26 0.69
27 0.74
28 0.73
29 0.71
30 0.71
31 0.71
32 0.75
33 0.67
34 0.59
35 0.54
36 0.46
37 0.44
38 0.39
39 0.31
40 0.27
41 0.28
42 0.29
43 0.28
44 0.26
45 0.21
46 0.2
47 0.18
48 0.13
49 0.11
50 0.08
51 0.08
52 0.09
53 0.09
54 0.13
55 0.14
56 0.14
57 0.15
58 0.15
59 0.14
60 0.16
61 0.18
62 0.14
63 0.14
64 0.14
65 0.12
66 0.13
67 0.12
68 0.13
69 0.12
70 0.12
71 0.12
72 0.13
73 0.13
74 0.12
75 0.12
76 0.09
77 0.09
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.08
84 0.06
85 0.09
86 0.12
87 0.15
88 0.2
89 0.21
90 0.24
91 0.29
92 0.39
93 0.46
94 0.5
95 0.49
96 0.46
97 0.46
98 0.44
99 0.43
100 0.33
101 0.26
102 0.19
103 0.18
104 0.23
105 0.23
106 0.24
107 0.2
108 0.2
109 0.19
110 0.26
111 0.32
112 0.25
113 0.32
114 0.35
115 0.39
116 0.43
117 0.47
118 0.46
119 0.43
120 0.52
121 0.54
122 0.59
123 0.64
124 0.7
125 0.74
126 0.77
127 0.81
128 0.83
129 0.84
130 0.85
131 0.82
132 0.8
133 0.79
134 0.78
135 0.79
136 0.76
137 0.73
138 0.66
139 0.61
140 0.53
141 0.48
142 0.45
143 0.43
144 0.43
145 0.42
146 0.45
147 0.51
148 0.58
149 0.65
150 0.71
151 0.74
152 0.76
153 0.8
154 0.82
155 0.85
156 0.85
157 0.84
158 0.84
159 0.83
160 0.84
161 0.83
162 0.85