Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K047

Protein Details
Accession I2K047    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
433-452DDKFRRSYTRKGAKNEETLAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000590  HMG_CoA_synt_AS  
IPR013746  HMG_CoA_synt_C_dom  
IPR013528  HMG_CoA_synth_N  
IPR010122  HMG_CoA_synthase_euk  
IPR016039  Thiolase-like  
Gene Ontology GO:0004421  F:hydroxymethylglutaryl-CoA synthase activity  
GO:0006084  P:acetyl-CoA metabolic process  
GO:0010142  P:farnesyl diphosphate biosynthetic process, mevalonate pathway  
Pfam View protein in Pfam  
PF08540  HMG_CoA_synt_C  
PF01154  HMG_CoA_synt_N  
PROSITE View protein in PROSITE  
PS01226  HMG_COA_SYNTHASE  
CDD cd00827  init_cond_enzymes  
Amino Acid Sequences MSPKNVGIKALELYIPGQYVHQADLEKYDGASTGKYTIGLGQTNMAFVNDREDIYSMALTVLKNLIDKYDXDVNNIGRLEVGTETLLDRSKSVKTLLMQLLGDNTDVEGVDTINACYGGTAAVINAINWVQSDSWDGRDAVVVCGDIAIYSKGAARPTGGAGTVALLIGPDAPIVFDPVRGSFMEHAYDFYKPDFASEYPYVAGHYSMACYVKAVDHCYKAYSKKAKARGLSDSKTDTVGLDYFDYNAFHAPTCKLVVKSYARLLYNDYMQDNSLIPDLDAKTYNEMSYEDSLVDKALQRKFMALAKDKYEERVKPSLELPTNIGNTYXGSCWGCLSSLLYFVGSEKLQGKRIGLFSYGSGLAATLLSMKVVGDISKITKVLSVKERLDSRIQKSPKEYEEAIELREKAYMKKSFKPVGSIDYIPEGTYYLKEIDDKFRRSYTRKGAKNEETLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.12
5 0.13
6 0.14
7 0.14
8 0.16
9 0.16
10 0.16
11 0.19
12 0.21
13 0.18
14 0.17
15 0.16
16 0.15
17 0.15
18 0.15
19 0.13
20 0.13
21 0.13
22 0.13
23 0.13
24 0.15
25 0.18
26 0.19
27 0.18
28 0.19
29 0.19
30 0.19
31 0.19
32 0.16
33 0.13
34 0.12
35 0.16
36 0.14
37 0.14
38 0.15
39 0.15
40 0.15
41 0.16
42 0.16
43 0.11
44 0.1
45 0.12
46 0.11
47 0.11
48 0.12
49 0.11
50 0.13
51 0.13
52 0.13
53 0.13
54 0.14
55 0.16
56 0.22
57 0.22
58 0.23
59 0.26
60 0.27
61 0.26
62 0.25
63 0.22
64 0.14
65 0.15
66 0.13
67 0.1
68 0.08
69 0.08
70 0.09
71 0.1
72 0.12
73 0.11
74 0.12
75 0.13
76 0.15
77 0.17
78 0.18
79 0.2
80 0.19
81 0.28
82 0.29
83 0.3
84 0.28
85 0.26
86 0.26
87 0.23
88 0.21
89 0.13
90 0.1
91 0.07
92 0.07
93 0.07
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.06
117 0.06
118 0.1
119 0.1
120 0.12
121 0.14
122 0.14
123 0.13
124 0.16
125 0.17
126 0.14
127 0.13
128 0.11
129 0.09
130 0.09
131 0.08
132 0.05
133 0.05
134 0.05
135 0.04
136 0.05
137 0.07
138 0.09
139 0.1
140 0.1
141 0.1
142 0.11
143 0.12
144 0.12
145 0.11
146 0.09
147 0.08
148 0.08
149 0.08
150 0.06
151 0.05
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.02
158 0.03
159 0.03
160 0.06
161 0.06
162 0.07
163 0.08
164 0.08
165 0.1
166 0.1
167 0.12
168 0.1
169 0.12
170 0.12
171 0.12
172 0.13
173 0.12
174 0.13
175 0.12
176 0.11
177 0.12
178 0.1
179 0.11
180 0.12
181 0.11
182 0.16
183 0.16
184 0.17
185 0.15
186 0.15
187 0.15
188 0.12
189 0.12
190 0.07
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.09
199 0.1
200 0.14
201 0.15
202 0.17
203 0.17
204 0.19
205 0.22
206 0.22
207 0.29
208 0.32
209 0.36
210 0.41
211 0.49
212 0.53
213 0.53
214 0.54
215 0.55
216 0.54
217 0.49
218 0.45
219 0.39
220 0.34
221 0.31
222 0.28
223 0.19
224 0.13
225 0.12
226 0.1
227 0.08
228 0.08
229 0.08
230 0.08
231 0.08
232 0.07
233 0.08
234 0.08
235 0.07
236 0.08
237 0.08
238 0.09
239 0.11
240 0.13
241 0.13
242 0.13
243 0.2
244 0.21
245 0.24
246 0.26
247 0.29
248 0.27
249 0.27
250 0.3
251 0.25
252 0.24
253 0.23
254 0.19
255 0.15
256 0.15
257 0.15
258 0.12
259 0.11
260 0.09
261 0.08
262 0.07
263 0.1
264 0.1
265 0.11
266 0.12
267 0.12
268 0.14
269 0.15
270 0.15
271 0.12
272 0.12
273 0.13
274 0.13
275 0.13
276 0.11
277 0.11
278 0.11
279 0.1
280 0.11
281 0.11
282 0.16
283 0.18
284 0.2
285 0.2
286 0.21
287 0.23
288 0.26
289 0.29
290 0.3
291 0.31
292 0.32
293 0.36
294 0.36
295 0.38
296 0.41
297 0.37
298 0.36
299 0.39
300 0.36
301 0.35
302 0.36
303 0.4
304 0.35
305 0.34
306 0.31
307 0.29
308 0.3
309 0.27
310 0.26
311 0.18
312 0.16
313 0.17
314 0.19
315 0.14
316 0.13
317 0.13
318 0.13
319 0.13
320 0.14
321 0.13
322 0.08
323 0.1
324 0.1
325 0.1
326 0.09
327 0.1
328 0.12
329 0.1
330 0.12
331 0.15
332 0.18
333 0.22
334 0.23
335 0.24
336 0.26
337 0.28
338 0.27
339 0.24
340 0.22
341 0.18
342 0.2
343 0.19
344 0.14
345 0.12
346 0.1
347 0.09
348 0.08
349 0.07
350 0.05
351 0.05
352 0.05
353 0.05
354 0.05
355 0.06
356 0.06
357 0.06
358 0.06
359 0.08
360 0.11
361 0.13
362 0.14
363 0.13
364 0.16
365 0.17
366 0.23
367 0.29
368 0.34
369 0.34
370 0.4
371 0.43
372 0.44
373 0.52
374 0.53
375 0.51
376 0.54
377 0.56
378 0.55
379 0.58
380 0.62
381 0.56
382 0.55
383 0.5
384 0.42
385 0.46
386 0.42
387 0.38
388 0.35
389 0.32
390 0.26
391 0.29
392 0.28
393 0.24
394 0.31
395 0.37
396 0.38
397 0.46
398 0.55
399 0.59
400 0.6
401 0.62
402 0.56
403 0.54
404 0.53
405 0.46
406 0.39
407 0.36
408 0.34
409 0.28
410 0.25
411 0.2
412 0.16
413 0.15
414 0.16
415 0.12
416 0.13
417 0.17
418 0.2
419 0.3
420 0.37
421 0.41
422 0.44
423 0.49
424 0.56
425 0.58
426 0.64
427 0.65
428 0.67
429 0.7
430 0.74
431 0.78
432 0.78