Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6AGS5

Protein Details
Accession A0A1A6AGS5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
199-219NYKPELHKKIKNRSGIRIRDMHydrophilic
NLS Segment(s)
PositionSequence
206-226KKIKNRSGIRIRDMNRAAKLK
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009305  Mpo1-like  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06127  Mpo1-like  
Amino Acid Sequences MSITPRKTRSQGPAEAIDLDHPPKEGKNHFDVEEELAFYSSYHANKINQAIHFVCIPQILWSWLLIIAHLPIPGTSPHILSTGLAFQPSLALGWIVAYLGYYVALEPVGGLTYLPIATLMYLTSTYLAVSPPTWLPFTDRSNPSAQPFGWAVFAFAWIAQFVGHGVFERRAPALFDNLVQALVLAPFFVHLEALFAFFNYKPELHKKIKNRSGIRIRDMNRAAKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.43
4 0.36
5 0.3
6 0.25
7 0.2
8 0.17
9 0.17
10 0.18
11 0.24
12 0.28
13 0.31
14 0.35
15 0.39
16 0.39
17 0.39
18 0.38
19 0.35
20 0.31
21 0.26
22 0.2
23 0.16
24 0.15
25 0.13
26 0.13
27 0.13
28 0.13
29 0.14
30 0.17
31 0.18
32 0.22
33 0.28
34 0.3
35 0.27
36 0.31
37 0.3
38 0.28
39 0.27
40 0.23
41 0.18
42 0.13
43 0.13
44 0.1
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.1
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.09
73 0.07
74 0.08
75 0.08
76 0.06
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.02
94 0.03
95 0.03
96 0.03
97 0.02
98 0.02
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.07
118 0.07
119 0.08
120 0.09
121 0.09
122 0.12
123 0.17
124 0.21
125 0.28
126 0.29
127 0.3
128 0.33
129 0.35
130 0.33
131 0.31
132 0.27
133 0.22
134 0.21
135 0.18
136 0.17
137 0.15
138 0.14
139 0.11
140 0.11
141 0.08
142 0.07
143 0.07
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.07
153 0.08
154 0.09
155 0.11
156 0.11
157 0.11
158 0.13
159 0.14
160 0.16
161 0.16
162 0.16
163 0.16
164 0.16
165 0.15
166 0.13
167 0.11
168 0.07
169 0.07
170 0.06
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.04
178 0.06
179 0.06
180 0.08
181 0.08
182 0.08
183 0.1
184 0.1
185 0.12
186 0.13
187 0.14
188 0.18
189 0.26
190 0.34
191 0.4
192 0.48
193 0.56
194 0.65
195 0.72
196 0.77
197 0.76
198 0.78
199 0.8
200 0.8
201 0.78
202 0.76
203 0.72
204 0.72
205 0.71
206 0.68