Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JU69

Protein Details
Accession I2JU69    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
346-369EKFLLKFCKVKRVGKKHYAMPMRAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 13.5, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MIVGMETYDVYTVFSPESQSSDYKLHLVTLNNHILSAIEDGKDKLYLKASSSTEGYPVIVTDSRTFKIRQQNQSNCLMLMNTDKVNGKDAGVSFDDFKSKLILEDVKPDVDTTGLITIRTIEQLRNTVDHSEDGKGYTLKDLFANSRASKAEFEDIISRQQIFEFRGCCYIAGDALVTTCIGKIVEKLIKQVVESGHELDIMEELNKFKYXEARKCVLDGEILEKYXXELIELCLRKFFGQDGINDDLIVRQFGLEVLRKHKTLKLDDFMIELKLRLPFNYTPQIKLNQALSGCYYTFGDDKLIAYLDDSMLSDDPVRRFAQLFSLKPQWEVTEIEPFIXSINKKGTKPEKFLLKFCKVKRVGKKHYAMPMRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.14
4 0.17
5 0.19
6 0.2
7 0.22
8 0.24
9 0.25
10 0.25
11 0.24
12 0.23
13 0.24
14 0.27
15 0.28
16 0.33
17 0.38
18 0.35
19 0.35
20 0.32
21 0.28
22 0.25
23 0.24
24 0.18
25 0.13
26 0.14
27 0.15
28 0.16
29 0.19
30 0.19
31 0.18
32 0.21
33 0.22
34 0.23
35 0.3
36 0.3
37 0.3
38 0.32
39 0.3
40 0.26
41 0.25
42 0.23
43 0.15
44 0.14
45 0.14
46 0.13
47 0.14
48 0.17
49 0.2
50 0.21
51 0.24
52 0.25
53 0.29
54 0.38
55 0.46
56 0.52
57 0.59
58 0.66
59 0.68
60 0.73
61 0.68
62 0.57
63 0.48
64 0.37
65 0.28
66 0.23
67 0.21
68 0.15
69 0.17
70 0.18
71 0.18
72 0.22
73 0.21
74 0.18
75 0.18
76 0.18
77 0.19
78 0.19
79 0.19
80 0.17
81 0.18
82 0.19
83 0.16
84 0.16
85 0.14
86 0.13
87 0.12
88 0.14
89 0.17
90 0.16
91 0.23
92 0.24
93 0.23
94 0.23
95 0.22
96 0.19
97 0.14
98 0.13
99 0.08
100 0.1
101 0.1
102 0.09
103 0.09
104 0.1
105 0.1
106 0.13
107 0.13
108 0.1
109 0.12
110 0.16
111 0.17
112 0.18
113 0.18
114 0.17
115 0.17
116 0.18
117 0.18
118 0.16
119 0.15
120 0.14
121 0.15
122 0.14
123 0.13
124 0.14
125 0.13
126 0.12
127 0.12
128 0.13
129 0.13
130 0.16
131 0.2
132 0.18
133 0.2
134 0.2
135 0.2
136 0.2
137 0.2
138 0.19
139 0.14
140 0.15
141 0.16
142 0.16
143 0.17
144 0.17
145 0.15
146 0.13
147 0.13
148 0.14
149 0.13
150 0.15
151 0.14
152 0.14
153 0.16
154 0.16
155 0.15
156 0.14
157 0.12
158 0.09
159 0.08
160 0.07
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.08
172 0.12
173 0.12
174 0.14
175 0.15
176 0.16
177 0.16
178 0.18
179 0.15
180 0.14
181 0.15
182 0.14
183 0.13
184 0.12
185 0.12
186 0.09
187 0.09
188 0.06
189 0.06
190 0.05
191 0.06
192 0.06
193 0.06
194 0.07
195 0.09
196 0.18
197 0.21
198 0.27
199 0.29
200 0.31
201 0.31
202 0.34
203 0.33
204 0.25
205 0.22
206 0.2
207 0.18
208 0.16
209 0.15
210 0.12
211 0.11
212 0.12
213 0.11
214 0.08
215 0.11
216 0.12
217 0.13
218 0.15
219 0.15
220 0.13
221 0.14
222 0.13
223 0.16
224 0.17
225 0.17
226 0.21
227 0.24
228 0.24
229 0.23
230 0.22
231 0.17
232 0.15
233 0.14
234 0.09
235 0.05
236 0.05
237 0.06
238 0.09
239 0.12
240 0.15
241 0.2
242 0.23
243 0.24
244 0.27
245 0.29
246 0.33
247 0.36
248 0.41
249 0.39
250 0.39
251 0.39
252 0.38
253 0.36
254 0.31
255 0.24
256 0.17
257 0.15
258 0.16
259 0.16
260 0.14
261 0.18
262 0.18
263 0.24
264 0.34
265 0.33
266 0.33
267 0.36
268 0.4
269 0.36
270 0.38
271 0.33
272 0.27
273 0.26
274 0.24
275 0.22
276 0.2
277 0.19
278 0.17
279 0.15
280 0.14
281 0.14
282 0.13
283 0.13
284 0.11
285 0.12
286 0.12
287 0.12
288 0.1
289 0.1
290 0.1
291 0.09
292 0.09
293 0.08
294 0.09
295 0.09
296 0.09
297 0.11
298 0.15
299 0.15
300 0.19
301 0.19
302 0.19
303 0.2
304 0.2
305 0.27
306 0.31
307 0.33
308 0.36
309 0.43
310 0.42
311 0.42
312 0.43
313 0.35
314 0.3
315 0.3
316 0.26
317 0.27
318 0.27
319 0.26
320 0.24
321 0.23
322 0.23
323 0.25
324 0.23
325 0.21
326 0.28
327 0.32
328 0.4
329 0.5
330 0.56
331 0.59
332 0.65
333 0.7
334 0.67
335 0.71
336 0.72
337 0.72
338 0.72
339 0.69
340 0.72
341 0.69
342 0.74
343 0.76
344 0.78
345 0.79
346 0.8
347 0.84
348 0.81
349 0.84
350 0.83