Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1H2

Protein Details
Accession I2K1H2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
133-153GDSPDKFKKKVDRSEKDIEYKBasic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039657  Dimethylallyltransferase  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF01715  IPPT  
Amino Acid Sequences MXIWQRLMGSVLSIFKXKPKPIISIIGTTGVGKSDLGVYLAETFNGEIINADSMQMYKGLPEITNKQPINERHGIVHHVINHVNWDEEYHIHRFQKECFKAIKRIHKKGKIPILVGGTHYYLQSVLFLNKTVDSGDSPDKFKKKVXDRXSEKDIEYKXT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.34
3 0.33
4 0.37
5 0.37
6 0.39
7 0.41
8 0.43
9 0.44
10 0.36
11 0.37
12 0.31
13 0.26
14 0.23
15 0.17
16 0.13
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.04
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.05
43 0.06
44 0.07
45 0.07
46 0.1
47 0.15
48 0.19
49 0.28
50 0.28
51 0.28
52 0.33
53 0.35
54 0.39
55 0.38
56 0.34
57 0.27
58 0.28
59 0.29
60 0.24
61 0.24
62 0.18
63 0.16
64 0.15
65 0.14
66 0.14
67 0.13
68 0.11
69 0.09
70 0.08
71 0.07
72 0.09
73 0.11
74 0.13
75 0.16
76 0.17
77 0.19
78 0.2
79 0.24
80 0.33
81 0.32
82 0.32
83 0.36
84 0.39
85 0.46
86 0.52
87 0.59
88 0.58
89 0.67
90 0.73
91 0.75
92 0.77
93 0.77
94 0.79
95 0.73
96 0.65
97 0.59
98 0.52
99 0.44
100 0.39
101 0.32
102 0.24
103 0.19
104 0.18
105 0.14
106 0.11
107 0.1
108 0.1
109 0.09
110 0.1
111 0.1
112 0.11
113 0.12
114 0.12
115 0.13
116 0.12
117 0.12
118 0.11
119 0.15
120 0.21
121 0.23
122 0.27
123 0.35
124 0.38
125 0.39
126 0.45
127 0.51
128 0.53
129 0.61
130 0.68
131 0.7
132 0.73
133 0.81
134 0.81