Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A500

Protein Details
Accession A0A1A6A500    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-76SDWTWHNPKKSCRRKNKSLYCPLQKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MKLKLRPKRIVRLFEDDLSDAPPVTASFDLSFEVEYPTGMKLVAFHAVPLSDWTWHNPKKSCRRKNKSLYCPLQKPIVTDQCEHANTQSSSTPLIPSSTTVADAGAAAGDAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.59
3 0.49
4 0.4
5 0.33
6 0.27
7 0.18
8 0.13
9 0.11
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.11
17 0.1
18 0.11
19 0.09
20 0.1
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.06
28 0.05
29 0.07
30 0.09
31 0.08
32 0.07
33 0.08
34 0.08
35 0.08
36 0.09
37 0.08
38 0.08
39 0.08
40 0.11
41 0.19
42 0.22
43 0.26
44 0.3
45 0.38
46 0.47
47 0.58
48 0.65
49 0.69
50 0.75
51 0.81
52 0.87
53 0.9
54 0.89
55 0.88
56 0.87
57 0.84
58 0.8
59 0.72
60 0.67
61 0.57
62 0.5
63 0.47
64 0.46
65 0.4
66 0.36
67 0.37
68 0.37
69 0.37
70 0.35
71 0.28
72 0.27
73 0.25
74 0.26
75 0.25
76 0.19
77 0.2
78 0.2
79 0.21
80 0.15
81 0.16
82 0.14
83 0.14
84 0.16
85 0.15
86 0.15
87 0.14
88 0.13
89 0.12
90 0.11
91 0.1
92 0.06
93 0.05