Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A6AE01

Protein Details
Accession A0A1A6AE01    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
105-128DFSPKQCRDQWHRNVGKKLRKALSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.666, mito_nucl 11.499, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MPTHNSIKRSLSSSPLPSADFPADMKPLVSSPVTPKKIKGNKTIKAETPNRSSPDSTPQKAKTNGSGFSPASEGWTARDRLELFEAIVGNVDIKWNEVSLKMSSDFSPKQCRDQWHRNVGKKLRKALSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.37
4 0.33
5 0.35
6 0.3
7 0.25
8 0.21
9 0.2
10 0.19
11 0.17
12 0.17
13 0.13
14 0.12
15 0.14
16 0.13
17 0.12
18 0.19
19 0.29
20 0.33
21 0.33
22 0.36
23 0.44
24 0.51
25 0.56
26 0.58
27 0.58
28 0.6
29 0.67
30 0.69
31 0.63
32 0.64
33 0.64
34 0.59
35 0.56
36 0.53
37 0.48
38 0.46
39 0.43
40 0.36
41 0.4
42 0.42
43 0.38
44 0.39
45 0.4
46 0.44
47 0.45
48 0.45
49 0.42
50 0.38
51 0.36
52 0.31
53 0.31
54 0.25
55 0.22
56 0.22
57 0.15
58 0.13
59 0.13
60 0.11
61 0.1
62 0.13
63 0.14
64 0.13
65 0.16
66 0.15
67 0.16
68 0.18
69 0.16
70 0.13
71 0.14
72 0.13
73 0.1
74 0.1
75 0.08
76 0.06
77 0.06
78 0.07
79 0.05
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.11
86 0.11
87 0.14
88 0.14
89 0.15
90 0.16
91 0.22
92 0.25
93 0.28
94 0.37
95 0.36
96 0.42
97 0.46
98 0.54
99 0.57
100 0.64
101 0.69
102 0.7
103 0.77
104 0.79
105 0.84
106 0.85
107 0.85
108 0.82
109 0.82
110 0.78