Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A5ZZD2

Protein Details
Accession A0A1A5ZZD2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-102HLPMHHHKTQGRRHRKRRQSYGGSSGNEBasic
NLS Segment(s)
PositionSequence
85-92GRRHRKRR
Subcellular Location(s) extr 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001461  Aspartic_peptidase_A1  
IPR001969  Aspartic_peptidase_AS  
IPR034164  Pepsin-like_dom  
IPR033121  PEPTIDASE_A1  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00026  Asp  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
PS51767  PEPTIDASE_A1  
CDD cd05471  pepsin_like  
Amino Acid Sequences MTRLFLLLLSLLAYLPAPAFAATSLKLSKHRTSSASGPLIQAQRRALARRQIAERALHIPMHHHTLRDTEERAIHLPMHHHKTQGRRHRKRRQSYGGSSGNEFIDVLSDLMDPYTRSIPTSVAALKDSSDPDEAANVIISQVTRTRTRTVSATVPTPTETAKAAGPANGEEPDLALDNTGGLAYTIDVDVGGVAIPVIVDTGSSAFWVPTSGCQTCKDAAMTISPLVVPDGCESQNITYGIGSAEGCYAHGAVQVGPYVVPDVELMGVTAVDKALASSGSVLSGILGLAGETNGDGQPTLVKAMYDLGLIKAKTVGFFLSEDENVDSESCDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.07
8 0.09
9 0.09
10 0.13
11 0.15
12 0.18
13 0.24
14 0.3
15 0.36
16 0.4
17 0.44
18 0.44
19 0.47
20 0.5
21 0.53
22 0.51
23 0.46
24 0.41
25 0.42
26 0.45
27 0.42
28 0.4
29 0.32
30 0.33
31 0.36
32 0.39
33 0.4
34 0.42
35 0.46
36 0.48
37 0.52
38 0.52
39 0.52
40 0.49
41 0.46
42 0.41
43 0.37
44 0.32
45 0.27
46 0.25
47 0.24
48 0.29
49 0.27
50 0.24
51 0.22
52 0.25
53 0.3
54 0.31
55 0.3
56 0.26
57 0.27
58 0.29
59 0.3
60 0.27
61 0.24
62 0.21
63 0.25
64 0.3
65 0.35
66 0.34
67 0.37
68 0.39
69 0.47
70 0.55
71 0.6
72 0.63
73 0.68
74 0.77
75 0.84
76 0.91
77 0.92
78 0.93
79 0.92
80 0.91
81 0.86
82 0.85
83 0.81
84 0.72
85 0.62
86 0.53
87 0.42
88 0.33
89 0.25
90 0.16
91 0.1
92 0.08
93 0.07
94 0.06
95 0.06
96 0.05
97 0.06
98 0.06
99 0.05
100 0.07
101 0.09
102 0.09
103 0.09
104 0.1
105 0.11
106 0.11
107 0.13
108 0.13
109 0.12
110 0.12
111 0.12
112 0.12
113 0.13
114 0.13
115 0.12
116 0.12
117 0.11
118 0.1
119 0.11
120 0.1
121 0.08
122 0.08
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.07
129 0.1
130 0.13
131 0.15
132 0.18
133 0.19
134 0.21
135 0.22
136 0.22
137 0.24
138 0.23
139 0.23
140 0.21
141 0.2
142 0.19
143 0.18
144 0.15
145 0.12
146 0.11
147 0.09
148 0.09
149 0.1
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.09
156 0.09
157 0.07
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.03
168 0.02
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.07
197 0.13
198 0.13
199 0.15
200 0.17
201 0.2
202 0.2
203 0.21
204 0.19
205 0.15
206 0.15
207 0.15
208 0.14
209 0.12
210 0.11
211 0.1
212 0.09
213 0.08
214 0.08
215 0.07
216 0.07
217 0.09
218 0.09
219 0.1
220 0.11
221 0.11
222 0.16
223 0.15
224 0.14
225 0.11
226 0.12
227 0.11
228 0.11
229 0.1
230 0.06
231 0.07
232 0.06
233 0.07
234 0.07
235 0.07
236 0.06
237 0.07
238 0.08
239 0.07
240 0.08
241 0.09
242 0.08
243 0.08
244 0.08
245 0.07
246 0.07
247 0.07
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.05
254 0.05
255 0.05
256 0.05
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.05
263 0.05
264 0.06
265 0.06
266 0.06
267 0.07
268 0.06
269 0.06
270 0.06
271 0.05
272 0.04
273 0.04
274 0.03
275 0.04
276 0.04
277 0.04
278 0.03
279 0.05
280 0.05
281 0.06
282 0.06
283 0.06
284 0.08
285 0.09
286 0.11
287 0.1
288 0.09
289 0.1
290 0.12
291 0.12
292 0.12
293 0.12
294 0.13
295 0.17
296 0.17
297 0.17
298 0.18
299 0.18
300 0.18
301 0.18
302 0.16
303 0.13
304 0.14
305 0.15
306 0.17
307 0.16
308 0.18
309 0.18
310 0.18
311 0.17
312 0.17