Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A5ZZ99

Protein Details
Accession A0A1A5ZZ99    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-171PLTPVQKQARDKKRREEAKNKAREKMGLRVKKRKTLKEKKAEEEWKVRBasic
NLS Segment(s)
PositionSequence
132-179ARDKKRREEAKNKAREKMGLRVKKRKTLKEKKAEEEWKVRELEKRIKG
Subcellular Location(s) nucl 14.5, cyto_nucl 8, plas 4, E.R. 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASYQPIPSSDPLDLDSTPQHETDPSYRPLRRSVQEEFNRPPPSWWKRTLLILVILAMAWFSIWLGRKGMEEKGPTIIYANRYSDEHKYRPAASPVITEYLSGNRIRLRGASIGGVGIEEKDIPLTPVQKQARDKKRREEAKNKAREKMGLRVKKRKTLKEKKAEEEWKVRELEKRIKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.19
5 0.2
6 0.19
7 0.18
8 0.16
9 0.2
10 0.23
11 0.26
12 0.28
13 0.35
14 0.38
15 0.4
16 0.45
17 0.49
18 0.49
19 0.49
20 0.5
21 0.53
22 0.57
23 0.62
24 0.6
25 0.61
26 0.59
27 0.53
28 0.5
29 0.5
30 0.51
31 0.5
32 0.5
33 0.47
34 0.46
35 0.49
36 0.49
37 0.4
38 0.34
39 0.28
40 0.23
41 0.18
42 0.15
43 0.11
44 0.08
45 0.05
46 0.03
47 0.03
48 0.02
49 0.04
50 0.06
51 0.07
52 0.08
53 0.09
54 0.11
55 0.13
56 0.16
57 0.17
58 0.17
59 0.17
60 0.2
61 0.19
62 0.18
63 0.17
64 0.17
65 0.16
66 0.17
67 0.17
68 0.15
69 0.16
70 0.19
71 0.24
72 0.27
73 0.26
74 0.26
75 0.27
76 0.28
77 0.3
78 0.3
79 0.25
80 0.2
81 0.2
82 0.18
83 0.17
84 0.16
85 0.13
86 0.12
87 0.11
88 0.13
89 0.12
90 0.12
91 0.11
92 0.12
93 0.12
94 0.12
95 0.13
96 0.12
97 0.12
98 0.12
99 0.1
100 0.1
101 0.09
102 0.09
103 0.06
104 0.05
105 0.04
106 0.04
107 0.03
108 0.04
109 0.04
110 0.05
111 0.07
112 0.1
113 0.11
114 0.21
115 0.24
116 0.29
117 0.37
118 0.47
119 0.56
120 0.64
121 0.69
122 0.7
123 0.78
124 0.82
125 0.84
126 0.84
127 0.85
128 0.85
129 0.89
130 0.83
131 0.79
132 0.71
133 0.68
134 0.61
135 0.6
136 0.6
137 0.59
138 0.64
139 0.68
140 0.72
141 0.75
142 0.8
143 0.81
144 0.82
145 0.83
146 0.85
147 0.86
148 0.88
149 0.86
150 0.87
151 0.85
152 0.81
153 0.8
154 0.73
155 0.68
156 0.62
157 0.57
158 0.53
159 0.53
160 0.55