Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JU17

Protein Details
Accession I2JU17    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
529-552LEKKAMQLKLKEKRLKERIASRGTHydrophilic
NLS Segment(s)
PositionSequence
535-549KKAMQLKLKEKRLKE
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
IPR016491  Septin  
Gene Ontology GO:0005938  C:cell cortex  
GO:0005935  C:cellular bud neck  
GO:0032156  C:septin cytoskeleton  
GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
CDD cd01850  CDC_Septin  
Amino Acid Sequences MAFRVSPSLLKRQRELKRGTRFTLMVCGPSGTGKTSFVNSLVDKNILAHRYQASGTKSGKKADEDLTIPKTVTFSNISGVIENAAEXRRAFDPQTANKEPGIAITETEVEIVDDDDSKLFLKVVDTPGFGENLDNTLCVNEICNYLEQQFDMVLAEETKVRRNPRFQDTRVHACLYFLPPTGHGLRELDVLAMKRMAKYVNVIPVVSRADSFTKTELINFKRRINEDIERMHIPVFQFSCDEDEDEPEXVEEAHFLQHLQPFAIVTSDEVATLKNGTRTRVRSYPWGQVDINDPDLSDFAILRSTVLGSHLQDLKDITHDFLYENYRTERLSAVSGLKGDFPRDTTAASLAASTADAPSMSNLAAIANSRSMRQFGGAGXEKEQXGAEKDADGAEKDADGADGETPNHENSSSMLYPESSTAKMPDLLRMKTSSGYSLGDDQELKSMTTDEDSDAGGNAGAKSPSVGSSGAGSGTSAAETSKESMVVDTRRLRKISETVPYMLRHQNLLTKQQKLEELERRSALSLAKRAAELEKKAMQLKLKEKRLKERIASRGTVAESSSSXSVRTASSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.72
4 0.76
5 0.78
6 0.76
7 0.73
8 0.66
9 0.58
10 0.58
11 0.49
12 0.4
13 0.34
14 0.3
15 0.24
16 0.24
17 0.23
18 0.17
19 0.17
20 0.18
21 0.19
22 0.2
23 0.21
24 0.21
25 0.24
26 0.23
27 0.26
28 0.26
29 0.25
30 0.22
31 0.23
32 0.28
33 0.25
34 0.24
35 0.24
36 0.23
37 0.25
38 0.26
39 0.29
40 0.27
41 0.33
42 0.38
43 0.42
44 0.44
45 0.47
46 0.49
47 0.46
48 0.47
49 0.44
50 0.45
51 0.39
52 0.42
53 0.4
54 0.38
55 0.35
56 0.3
57 0.27
58 0.22
59 0.22
60 0.19
61 0.16
62 0.17
63 0.19
64 0.19
65 0.18
66 0.18
67 0.16
68 0.12
69 0.12
70 0.11
71 0.1
72 0.1
73 0.11
74 0.12
75 0.16
76 0.17
77 0.19
78 0.26
79 0.31
80 0.4
81 0.42
82 0.43
83 0.38
84 0.38
85 0.36
86 0.3
87 0.27
88 0.18
89 0.14
90 0.13
91 0.14
92 0.13
93 0.13
94 0.11
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.12
109 0.18
110 0.19
111 0.19
112 0.21
113 0.22
114 0.22
115 0.21
116 0.17
117 0.12
118 0.11
119 0.11
120 0.09
121 0.08
122 0.08
123 0.08
124 0.07
125 0.08
126 0.07
127 0.09
128 0.1
129 0.11
130 0.12
131 0.13
132 0.13
133 0.12
134 0.11
135 0.09
136 0.08
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.09
143 0.1
144 0.16
145 0.2
146 0.26
147 0.31
148 0.39
149 0.45
150 0.52
151 0.61
152 0.58
153 0.63
154 0.64
155 0.67
156 0.62
157 0.57
158 0.47
159 0.39
160 0.39
161 0.32
162 0.27
163 0.2
164 0.18
165 0.16
166 0.2
167 0.2
168 0.18
169 0.16
170 0.15
171 0.14
172 0.15
173 0.14
174 0.11
175 0.11
176 0.11
177 0.11
178 0.12
179 0.12
180 0.11
181 0.12
182 0.12
183 0.11
184 0.14
185 0.17
186 0.21
187 0.21
188 0.21
189 0.2
190 0.22
191 0.22
192 0.19
193 0.16
194 0.11
195 0.13
196 0.14
197 0.15
198 0.14
199 0.15
200 0.15
201 0.18
202 0.23
203 0.26
204 0.33
205 0.35
206 0.38
207 0.42
208 0.43
209 0.43
210 0.42
211 0.42
212 0.39
213 0.38
214 0.38
215 0.33
216 0.32
217 0.29
218 0.24
219 0.2
220 0.18
221 0.15
222 0.12
223 0.12
224 0.12
225 0.14
226 0.12
227 0.14
228 0.1
229 0.12
230 0.12
231 0.12
232 0.12
233 0.09
234 0.09
235 0.08
236 0.07
237 0.05
238 0.05
239 0.04
240 0.05
241 0.07
242 0.08
243 0.09
244 0.09
245 0.09
246 0.08
247 0.08
248 0.08
249 0.06
250 0.04
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.06
258 0.07
259 0.11
260 0.12
261 0.15
262 0.2
263 0.23
264 0.28
265 0.31
266 0.32
267 0.36
268 0.38
269 0.44
270 0.4
271 0.41
272 0.36
273 0.32
274 0.35
275 0.28
276 0.26
277 0.17
278 0.16
279 0.12
280 0.12
281 0.11
282 0.07
283 0.05
284 0.04
285 0.05
286 0.05
287 0.04
288 0.05
289 0.05
290 0.04
291 0.06
292 0.07
293 0.07
294 0.11
295 0.13
296 0.13
297 0.13
298 0.14
299 0.13
300 0.14
301 0.14
302 0.11
303 0.09
304 0.1
305 0.09
306 0.11
307 0.14
308 0.13
309 0.14
310 0.15
311 0.15
312 0.15
313 0.15
314 0.14
315 0.11
316 0.12
317 0.12
318 0.12
319 0.12
320 0.13
321 0.12
322 0.14
323 0.13
324 0.13
325 0.12
326 0.12
327 0.14
328 0.14
329 0.14
330 0.11
331 0.12
332 0.11
333 0.11
334 0.09
335 0.07
336 0.06
337 0.06
338 0.05
339 0.04
340 0.04
341 0.04
342 0.04
343 0.04
344 0.05
345 0.05
346 0.05
347 0.05
348 0.05
349 0.05
350 0.06
351 0.06
352 0.08
353 0.09
354 0.1
355 0.11
356 0.12
357 0.12
358 0.12
359 0.12
360 0.1
361 0.19
362 0.19
363 0.19
364 0.2
365 0.2
366 0.19
367 0.19
368 0.18
369 0.11
370 0.11
371 0.1
372 0.12
373 0.12
374 0.12
375 0.12
376 0.13
377 0.11
378 0.1
379 0.1
380 0.06
381 0.06
382 0.06
383 0.06
384 0.06
385 0.07
386 0.07
387 0.08
388 0.1
389 0.1
390 0.1
391 0.1
392 0.09
393 0.09
394 0.16
395 0.14
396 0.14
397 0.14
398 0.14
399 0.14
400 0.16
401 0.17
402 0.12
403 0.12
404 0.13
405 0.14
406 0.18
407 0.18
408 0.23
409 0.27
410 0.27
411 0.29
412 0.29
413 0.29
414 0.27
415 0.28
416 0.22
417 0.19
418 0.19
419 0.18
420 0.19
421 0.19
422 0.18
423 0.18
424 0.16
425 0.18
426 0.17
427 0.16
428 0.13
429 0.13
430 0.12
431 0.12
432 0.13
433 0.1
434 0.1
435 0.11
436 0.1
437 0.09
438 0.09
439 0.08
440 0.08
441 0.07
442 0.08
443 0.08
444 0.08
445 0.08
446 0.09
447 0.09
448 0.1
449 0.1
450 0.09
451 0.1
452 0.11
453 0.11
454 0.1
455 0.09
456 0.08
457 0.08
458 0.07
459 0.06
460 0.05
461 0.06
462 0.07
463 0.1
464 0.1
465 0.1
466 0.1
467 0.12
468 0.17
469 0.19
470 0.25
471 0.31
472 0.37
473 0.43
474 0.44
475 0.44
476 0.44
477 0.49
478 0.48
479 0.48
480 0.46
481 0.43
482 0.47
483 0.47
484 0.47
485 0.45
486 0.4
487 0.33
488 0.31
489 0.35
490 0.35
491 0.44
492 0.45
493 0.46
494 0.46
495 0.48
496 0.52
497 0.5
498 0.55
499 0.54
500 0.53
501 0.53
502 0.53
503 0.5
504 0.46
505 0.42
506 0.38
507 0.36
508 0.35
509 0.33
510 0.33
511 0.32
512 0.32
513 0.37
514 0.4
515 0.36
516 0.37
517 0.39
518 0.41
519 0.45
520 0.47
521 0.46
522 0.48
523 0.54
524 0.58
525 0.63
526 0.68
527 0.71
528 0.78
529 0.81
530 0.82
531 0.81
532 0.81
533 0.8
534 0.79
535 0.74
536 0.66
537 0.61
538 0.54
539 0.46
540 0.37
541 0.29
542 0.23
543 0.23
544 0.22
545 0.18
546 0.16
547 0.16