Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A043

Protein Details
Accession A0A1A6A043   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
185-210EEFFRLKKVQGKKKRDAEKANESRQTHydrophilic
NLS Segment(s)
PositionSequence
192-199KVQGKKKR
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002699  V_ATPase_D  
Gene Ontology GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF01813  ATP-synt_D  
Amino Acid Sequences MNLTLTKTRLKGAQTGHSLLAKKRDALTTRFRTILKKVDEAKRLTGRVLQLASFSLAEVTYTAGDIGYQVQESVKKASYTVQARQENVSGVVLPAFEGVRSKEASDFNLTGLSRGGQQIQKCRDTYVKAVGTLVELASLQTAFTILDEVIRATNRRVNAIEHVVIPRLDNTIKYINSELDEMDREEFFRLKKVQGKKKRDAEKANESRQTQNAEFTEGGGELHRDEGIGGGQAGGADMLDEGKDDDVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.45
4 0.45
5 0.45
6 0.42
7 0.45
8 0.39
9 0.36
10 0.36
11 0.41
12 0.4
13 0.43
14 0.51
15 0.5
16 0.52
17 0.53
18 0.51
19 0.48
20 0.5
21 0.52
22 0.47
23 0.47
24 0.51
25 0.55
26 0.6
27 0.59
28 0.62
29 0.59
30 0.55
31 0.49
32 0.45
33 0.39
34 0.37
35 0.34
36 0.26
37 0.21
38 0.2
39 0.2
40 0.16
41 0.13
42 0.09
43 0.07
44 0.07
45 0.07
46 0.07
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.06
57 0.07
58 0.09
59 0.11
60 0.13
61 0.14
62 0.14
63 0.14
64 0.18
65 0.24
66 0.27
67 0.32
68 0.38
69 0.39
70 0.4
71 0.41
72 0.39
73 0.32
74 0.28
75 0.22
76 0.13
77 0.1
78 0.09
79 0.07
80 0.06
81 0.06
82 0.05
83 0.04
84 0.05
85 0.06
86 0.08
87 0.09
88 0.09
89 0.12
90 0.13
91 0.15
92 0.18
93 0.17
94 0.15
95 0.18
96 0.17
97 0.14
98 0.14
99 0.12
100 0.09
101 0.09
102 0.12
103 0.11
104 0.14
105 0.21
106 0.25
107 0.28
108 0.27
109 0.29
110 0.29
111 0.28
112 0.29
113 0.29
114 0.25
115 0.22
116 0.22
117 0.2
118 0.18
119 0.16
120 0.13
121 0.06
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.03
133 0.04
134 0.04
135 0.05
136 0.06
137 0.07
138 0.08
139 0.09
140 0.12
141 0.12
142 0.15
143 0.16
144 0.16
145 0.19
146 0.22
147 0.22
148 0.2
149 0.21
150 0.19
151 0.18
152 0.17
153 0.13
154 0.12
155 0.12
156 0.1
157 0.13
158 0.17
159 0.18
160 0.19
161 0.2
162 0.19
163 0.19
164 0.2
165 0.16
166 0.13
167 0.14
168 0.13
169 0.13
170 0.12
171 0.12
172 0.13
173 0.14
174 0.13
175 0.18
176 0.19
177 0.23
178 0.31
179 0.4
180 0.5
181 0.58
182 0.67
183 0.71
184 0.79
185 0.83
186 0.85
187 0.84
188 0.82
189 0.83
190 0.83
191 0.82
192 0.79
193 0.72
194 0.67
195 0.62
196 0.6
197 0.5
198 0.47
199 0.39
200 0.36
201 0.33
202 0.29
203 0.26
204 0.19
205 0.18
206 0.12
207 0.12
208 0.09
209 0.1
210 0.09
211 0.07
212 0.07
213 0.08
214 0.08
215 0.08
216 0.07
217 0.06
218 0.07
219 0.06
220 0.06
221 0.05
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.06