Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A5ZXR2

Protein Details
Accession A0A1A5ZXR2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-61LWEVNKGRRSKKKHKLRLDLVIRBasic
NLS Segment(s)
PositionSequence
44-54KGRRSKKKHKL
Subcellular Location(s) cysk 12, nucl 9.5, cyto_nucl 7.833, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTEEPIMEGFKLSNLELQVLEYISFAGITITKPLLAGLLWEVNKGRRSKKKHKLRLDLVIRGEVRFDIDEGLVQLEKKQDEGLLRIIRSPAGVKTADEWREMLDKRQWHRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.14
5 0.13
6 0.12
7 0.12
8 0.09
9 0.08
10 0.07
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.1
26 0.1
27 0.11
28 0.12
29 0.15
30 0.2
31 0.23
32 0.3
33 0.34
34 0.44
35 0.54
36 0.64
37 0.72
38 0.78
39 0.84
40 0.86
41 0.83
42 0.83
43 0.78
44 0.72
45 0.62
46 0.56
47 0.46
48 0.36
49 0.31
50 0.21
51 0.16
52 0.11
53 0.1
54 0.07
55 0.06
56 0.06
57 0.06
58 0.08
59 0.07
60 0.06
61 0.08
62 0.1
63 0.1
64 0.1
65 0.1
66 0.11
67 0.13
68 0.15
69 0.21
70 0.22
71 0.22
72 0.23
73 0.24
74 0.22
75 0.21
76 0.21
77 0.15
78 0.15
79 0.15
80 0.15
81 0.18
82 0.25
83 0.26
84 0.25
85 0.25
86 0.23
87 0.3
88 0.3
89 0.33
90 0.32
91 0.38