Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A6A4X3

Protein Details
Accession A0A1A6A4X3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-36ASSPPEKSPRKKKTDWTPDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MPTKREYSAVSDEKPIASSPPEKSPRKKKTDWTPDEEAKFLAIIDEIVKTHLWSMAKEDPDLAARKGGAVRSHWDALFKKLKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.21
4 0.19
5 0.21
6 0.21
7 0.3
8 0.38
9 0.44
10 0.53
11 0.62
12 0.69
13 0.73
14 0.75
15 0.75
16 0.77
17 0.82
18 0.79
19 0.75
20 0.72
21 0.69
22 0.64
23 0.55
24 0.44
25 0.33
26 0.26
27 0.18
28 0.11
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.06
38 0.09
39 0.09
40 0.09
41 0.15
42 0.19
43 0.2
44 0.2
45 0.2
46 0.18
47 0.22
48 0.24
49 0.19
50 0.15
51 0.14
52 0.16
53 0.18
54 0.2
55 0.19
56 0.19
57 0.23
58 0.27
59 0.31
60 0.29
61 0.33
62 0.32
63 0.37
64 0.45