Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A1H4

Protein Details
Accession A0A1A6A1H4   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
111-132LENPNPKSKQPPKPPSRLKPDHHydrophilic
NLS Segment(s)
PositionSequence
32-45KRPISPPPAGHKKR
114-127PNPKSKQPPKPPSR
Subcellular Location(s) mito_nucl 10.833, mito 10.5, nucl 10, cyto_nucl 7.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKDTNVRFLPPRQTNETSLHDHPNTDNRTRIKRPISPPPAGHKKRPYHSLLLRKPNPTLNPLPHDMIDGATGKNDATYWNDYYTTPYPINDSNKLPKPPHGIKLYSAKWKLENPNPKSKQPPKPPSRLKPDHPADNDEKAFYGNPMMSYGLMYPSMMGMGGMGGMGGMGMNPMGMGYGMGGGMGMMGYGMPRYGGVYLGIRSDIAGTVCMGTVAMDAYGMGMGMMGGGMGINNMPGSQLMMYGRGMPYNGWYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.59
4 0.55
5 0.51
6 0.52
7 0.45
8 0.42
9 0.42
10 0.45
11 0.45
12 0.43
13 0.46
14 0.45
15 0.53
16 0.57
17 0.62
18 0.61
19 0.64
20 0.68
21 0.72
22 0.73
23 0.71
24 0.7
25 0.72
26 0.75
27 0.72
28 0.73
29 0.72
30 0.73
31 0.73
32 0.75
33 0.7
34 0.68
35 0.72
36 0.74
37 0.73
38 0.75
39 0.74
40 0.69
41 0.67
42 0.64
43 0.57
44 0.53
45 0.51
46 0.46
47 0.46
48 0.46
49 0.45
50 0.38
51 0.37
52 0.3
53 0.24
54 0.19
55 0.15
56 0.12
57 0.1
58 0.1
59 0.08
60 0.08
61 0.08
62 0.07
63 0.1
64 0.14
65 0.15
66 0.16
67 0.17
68 0.17
69 0.23
70 0.24
71 0.23
72 0.2
73 0.19
74 0.2
75 0.24
76 0.29
77 0.27
78 0.29
79 0.33
80 0.38
81 0.43
82 0.42
83 0.42
84 0.46
85 0.47
86 0.5
87 0.46
88 0.42
89 0.4
90 0.47
91 0.46
92 0.46
93 0.43
94 0.38
95 0.35
96 0.39
97 0.43
98 0.43
99 0.49
100 0.46
101 0.55
102 0.57
103 0.58
104 0.63
105 0.65
106 0.67
107 0.68
108 0.73
109 0.7
110 0.76
111 0.82
112 0.81
113 0.82
114 0.78
115 0.71
116 0.71
117 0.68
118 0.66
119 0.58
120 0.55
121 0.48
122 0.47
123 0.43
124 0.33
125 0.28
126 0.21
127 0.19
128 0.14
129 0.12
130 0.07
131 0.07
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.01
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.03
178 0.03
179 0.04
180 0.04
181 0.05
182 0.07
183 0.08
184 0.09
185 0.1
186 0.1
187 0.09
188 0.09
189 0.09
190 0.09
191 0.08
192 0.08
193 0.07
194 0.07
195 0.07
196 0.07
197 0.06
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.03
208 0.03
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.03
218 0.03
219 0.03
220 0.04
221 0.04
222 0.04
223 0.06
224 0.06
225 0.09
226 0.09
227 0.11
228 0.12
229 0.15
230 0.15
231 0.15
232 0.16
233 0.14