Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A5ZY29

Protein Details
Accession A0A1A5ZY29    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
237-258LDVKKQSKAKSKSTSPEKKDASHydrophilic
NLS Segment(s)
PositionSequence
241-256KQSKAKSKSTSPEKKD
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR005061  Ist1  
IPR042277  IST1-like  
Gene Ontology GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03398  Ist1  
Amino Acid Sequences MVPWNGPRAKVQIKLSIQRLRTLQEKKLALAKSSRREIADLLNKNRIETARLRVESLVQDDIYVELLEILELYAETLQARFGLLDASTGEEPEPSIADAVCAIVYAAPRTELKELQVLRELLMHKFGRNFSLSLTTTPPPPSVPSRITSKLKVFVPSKELVDAYLSEIARGYGVDWAPEPAPDEEEAEEGIEPLKRDTKEDDSDYDQGSEGGGNEDERGGDKLDNPISGDEKVEKGLDVKKQSKAKSKSTSPEKKDASPIPPPAAAAAPKKLSPEEELAQRFERLKNLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.64
4 0.59
5 0.58
6 0.55
7 0.5
8 0.52
9 0.5
10 0.48
11 0.49
12 0.49
13 0.46
14 0.51
15 0.49
16 0.43
17 0.46
18 0.48
19 0.49
20 0.53
21 0.54
22 0.48
23 0.48
24 0.46
25 0.47
26 0.48
27 0.48
28 0.46
29 0.51
30 0.49
31 0.48
32 0.49
33 0.41
34 0.35
35 0.32
36 0.35
37 0.36
38 0.37
39 0.38
40 0.35
41 0.37
42 0.35
43 0.33
44 0.28
45 0.18
46 0.17
47 0.16
48 0.16
49 0.14
50 0.11
51 0.07
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.06
73 0.08
74 0.08
75 0.09
76 0.08
77 0.07
78 0.08
79 0.07
80 0.08
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.09
97 0.12
98 0.11
99 0.12
100 0.18
101 0.18
102 0.18
103 0.22
104 0.2
105 0.18
106 0.21
107 0.21
108 0.16
109 0.21
110 0.2
111 0.17
112 0.19
113 0.19
114 0.18
115 0.18
116 0.18
117 0.13
118 0.18
119 0.18
120 0.17
121 0.2
122 0.18
123 0.18
124 0.19
125 0.19
126 0.14
127 0.16
128 0.17
129 0.18
130 0.2
131 0.2
132 0.25
133 0.3
134 0.32
135 0.33
136 0.33
137 0.33
138 0.33
139 0.36
140 0.33
141 0.29
142 0.3
143 0.28
144 0.27
145 0.23
146 0.21
147 0.15
148 0.14
149 0.13
150 0.1
151 0.12
152 0.12
153 0.1
154 0.1
155 0.1
156 0.09
157 0.09
158 0.08
159 0.07
160 0.07
161 0.07
162 0.08
163 0.09
164 0.09
165 0.09
166 0.11
167 0.08
168 0.1
169 0.1
170 0.11
171 0.1
172 0.1
173 0.1
174 0.08
175 0.08
176 0.06
177 0.07
178 0.07
179 0.07
180 0.08
181 0.14
182 0.13
183 0.16
184 0.2
185 0.26
186 0.3
187 0.32
188 0.34
189 0.34
190 0.36
191 0.35
192 0.31
193 0.24
194 0.19
195 0.16
196 0.13
197 0.09
198 0.08
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.08
205 0.09
206 0.09
207 0.09
208 0.11
209 0.16
210 0.18
211 0.18
212 0.18
213 0.19
214 0.2
215 0.19
216 0.2
217 0.16
218 0.15
219 0.16
220 0.15
221 0.14
222 0.15
223 0.2
224 0.24
225 0.31
226 0.35
227 0.42
228 0.49
229 0.55
230 0.63
231 0.65
232 0.68
233 0.69
234 0.72
235 0.74
236 0.78
237 0.82
238 0.78
239 0.81
240 0.76
241 0.71
242 0.71
243 0.67
244 0.62
245 0.6
246 0.58
247 0.52
248 0.48
249 0.44
250 0.38
251 0.35
252 0.33
253 0.3
254 0.3
255 0.29
256 0.3
257 0.33
258 0.33
259 0.32
260 0.32
261 0.34
262 0.32
263 0.38
264 0.4
265 0.41
266 0.42
267 0.42
268 0.41
269 0.38