Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K3X7

Protein Details
Accession I2K3X7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
209-240ETGLKLKRKREMQKAERIKKAKHDSKPGYCENBasic
NLS Segment(s)
PositionSequence
221-239KLKRKREMQKAERIKKAKH
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006572  Znf_DBF  
IPR038545  Znf_DBF_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF07535  zf-DBF  
PROSITE View protein in PROSITE  
PS51265  ZF_DBF4  
Amino Acid Sequences MXRIPVLAPPDAHGEIGQKDANRQLLEIERSRMVDGEAXGSLPALLHREDSLMTLSGSKFKNEYGEIQASGVQNQSCSTAISGNNIGNGLAPSYSLVYNKKIANDKKKTISFNRSXXDNXKINDXMPLDGRKVSALDKENVVPKANADHLETRVRIVRKHPAGXQTLEAVTKRRKMXELDKIAEQKATEFVLEKRKLEKETSAEPRELSTAFKHAEETGLKLKRKREMQKAERIKKAKHDSKPGYCENCRVKYADFGEHIQTDKHRQFALNPANFREIDDLINTVNLTRRMGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.24
4 0.18
5 0.21
6 0.25
7 0.3
8 0.27
9 0.26
10 0.26
11 0.3
12 0.36
13 0.36
14 0.35
15 0.32
16 0.33
17 0.33
18 0.3
19 0.24
20 0.2
21 0.17
22 0.17
23 0.15
24 0.14
25 0.13
26 0.13
27 0.12
28 0.11
29 0.12
30 0.08
31 0.09
32 0.09
33 0.1
34 0.1
35 0.11
36 0.12
37 0.11
38 0.11
39 0.12
40 0.13
41 0.18
42 0.19
43 0.19
44 0.18
45 0.18
46 0.22
47 0.21
48 0.24
49 0.24
50 0.26
51 0.25
52 0.25
53 0.28
54 0.24
55 0.23
56 0.22
57 0.15
58 0.13
59 0.13
60 0.14
61 0.11
62 0.11
63 0.11
64 0.12
65 0.12
66 0.15
67 0.17
68 0.16
69 0.16
70 0.15
71 0.14
72 0.11
73 0.11
74 0.08
75 0.06
76 0.05
77 0.05
78 0.06
79 0.07
80 0.09
81 0.11
82 0.13
83 0.18
84 0.19
85 0.23
86 0.3
87 0.38
88 0.46
89 0.52
90 0.55
91 0.59
92 0.63
93 0.64
94 0.63
95 0.64
96 0.58
97 0.6
98 0.61
99 0.57
100 0.56
101 0.51
102 0.5
103 0.43
104 0.38
105 0.3
106 0.25
107 0.23
108 0.21
109 0.23
110 0.16
111 0.15
112 0.14
113 0.14
114 0.14
115 0.16
116 0.17
117 0.15
118 0.16
119 0.18
120 0.22
121 0.22
122 0.22
123 0.17
124 0.14
125 0.15
126 0.16
127 0.15
128 0.13
129 0.14
130 0.16
131 0.19
132 0.18
133 0.17
134 0.21
135 0.2
136 0.2
137 0.21
138 0.27
139 0.29
140 0.34
141 0.35
142 0.37
143 0.38
144 0.38
145 0.36
146 0.29
147 0.28
148 0.24
149 0.26
150 0.22
151 0.25
152 0.25
153 0.25
154 0.26
155 0.28
156 0.35
157 0.41
158 0.46
159 0.47
160 0.5
161 0.49
162 0.47
163 0.42
164 0.33
165 0.26
166 0.19
167 0.13
168 0.1
169 0.12
170 0.22
171 0.24
172 0.24
173 0.28
174 0.31
175 0.33
176 0.34
177 0.35
178 0.3
179 0.37
180 0.45
181 0.43
182 0.4
183 0.38
184 0.36
185 0.33
186 0.29
187 0.22
188 0.15
189 0.17
190 0.17
191 0.17
192 0.17
193 0.16
194 0.19
195 0.18
196 0.2
197 0.24
198 0.3
199 0.34
200 0.37
201 0.42
202 0.46
203 0.55
204 0.6
205 0.62
206 0.67
207 0.72
208 0.78
209 0.85
210 0.86
211 0.85
212 0.82
213 0.75
214 0.74
215 0.76
216 0.74
217 0.72
218 0.74
219 0.74
220 0.77
221 0.81
222 0.79
223 0.76
224 0.69
225 0.7
226 0.68
227 0.64
228 0.57
229 0.52
230 0.45
231 0.44
232 0.46
233 0.43
234 0.37
235 0.35
236 0.37
237 0.36
238 0.35
239 0.3
240 0.3
241 0.33
242 0.33
243 0.34
244 0.32
245 0.31
246 0.33
247 0.41
248 0.48
249 0.46
250 0.46
251 0.46
252 0.49
253 0.48
254 0.46
255 0.4
256 0.31
257 0.25
258 0.23
259 0.21
260 0.17
261 0.18
262 0.16
263 0.13
264 0.17
265 0.18