Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K0Z1

Protein Details
Accession I2K0Z1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-39AAAAGSKKSKKKWNKGKVKDRADHMHydrophilic
NLS Segment(s)
PositionSequence
12-33KAAAAAAGSKKSKKKWNKGKVK
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, mito 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPLKVQTTKAAKAAAAAAGSKKSKKKWNKGKVKDRADHMVILDQDKYDRILKDVPTYKFISVSVLVDRLKIGGSVARVALRQMEKDGLIKCVDKHSKQLIYTRATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.16
4 0.14
5 0.18
6 0.21
7 0.25
8 0.3
9 0.35
10 0.44
11 0.54
12 0.63
13 0.7
14 0.77
15 0.83
16 0.88
17 0.92
18 0.92
19 0.91
20 0.85
21 0.79
22 0.74
23 0.65
24 0.55
25 0.45
26 0.38
27 0.29
28 0.25
29 0.2
30 0.14
31 0.12
32 0.11
33 0.13
34 0.12
35 0.11
36 0.12
37 0.15
38 0.16
39 0.22
40 0.28
41 0.27
42 0.28
43 0.3
44 0.28
45 0.26
46 0.25
47 0.2
48 0.14
49 0.14
50 0.11
51 0.13
52 0.13
53 0.12
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.15
67 0.15
68 0.15
69 0.16
70 0.17
71 0.17
72 0.22
73 0.23
74 0.2
75 0.21
76 0.21
77 0.21
78 0.29
79 0.36
80 0.34
81 0.4
82 0.46
83 0.5
84 0.52
85 0.58
86 0.55