Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JWM0

Protein Details
Accession I2JWM0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
76-96NSTFSKSSRKRLEPRDKVKLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKARRVTIIPDXYDEDDISASEVTTNGGNMGISIRNPKQIKAIKEENMKEPEAIISASLGQREQAADXSXLEVRSSDMNSTFSKSSRKRLEPRDKVKLTHLLEQTKDFDMICTTMKRSKKEIYELLDMMDAWRIINA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.22
3 0.16
4 0.14
5 0.11
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.07
17 0.07
18 0.08
19 0.14
20 0.15
21 0.23
22 0.24
23 0.25
24 0.32
25 0.37
26 0.4
27 0.42
28 0.47
29 0.45
30 0.53
31 0.55
32 0.52
33 0.5
34 0.47
35 0.39
36 0.32
37 0.26
38 0.19
39 0.16
40 0.09
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.07
49 0.07
50 0.06
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.1
63 0.1
64 0.13
65 0.13
66 0.15
67 0.23
68 0.25
69 0.33
70 0.39
71 0.47
72 0.53
73 0.63
74 0.73
75 0.75
76 0.81
77 0.82
78 0.76
79 0.7
80 0.67
81 0.65
82 0.57
83 0.54
84 0.51
85 0.45
86 0.43
87 0.44
88 0.42
89 0.34
90 0.32
91 0.23
92 0.19
93 0.16
94 0.16
95 0.16
96 0.15
97 0.17
98 0.23
99 0.29
100 0.33
101 0.37
102 0.43
103 0.47
104 0.53
105 0.57
106 0.56
107 0.58
108 0.54
109 0.49
110 0.42
111 0.35
112 0.28
113 0.23
114 0.17