Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A4U4

Protein Details
Accession A0A1A6A4U4   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
27-48MDGQIKKKKKMPPSSPKKTKTSHydrophilic
NLS Segment(s)
PositionSequence
32-45KKKKKMPPSSPKKT
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MPAKRERENTPSSSSSSLSDKDVKLMMDGQIKKKKKMPPSSPKKTKTSWTAAEEATFKEGINVVVKRHLWTELKNDPQMAQRGANGIAQHWIALYKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.34
3 0.31
4 0.28
5 0.25
6 0.28
7 0.25
8 0.25
9 0.25
10 0.23
11 0.2
12 0.21
13 0.2
14 0.23
15 0.26
16 0.33
17 0.4
18 0.43
19 0.45
20 0.51
21 0.54
22 0.56
23 0.63
24 0.65
25 0.67
26 0.75
27 0.83
28 0.86
29 0.85
30 0.8
31 0.72
32 0.67
33 0.63
34 0.58
35 0.53
36 0.46
37 0.43
38 0.38
39 0.37
40 0.31
41 0.25
42 0.2
43 0.14
44 0.11
45 0.09
46 0.09
47 0.09
48 0.13
49 0.13
50 0.12
51 0.17
52 0.18
53 0.18
54 0.19
55 0.22
56 0.2
57 0.22
58 0.29
59 0.33
60 0.38
61 0.39
62 0.39
63 0.36
64 0.39
65 0.41
66 0.36
67 0.29
68 0.24
69 0.25
70 0.25
71 0.26
72 0.21
73 0.16
74 0.17
75 0.15
76 0.14
77 0.12
78 0.14