Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A5ZUS7

Protein Details
Accession A0A1A5ZUS7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31VTEPKAKGEKSKKQHSQVVIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR023753  FAD/NAD-binding_dom  
IPR008255  Pyr_nucl-diS_OxRdtase_2_AS  
IPR005982  Thioredox_Rdtase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0004791  F:thioredoxin-disulfide reductase activity  
GO:0019430  P:removal of superoxide radicals  
Pfam View protein in Pfam  
PF07992  Pyr_redox_2  
PROSITE View protein in PROSITE  
PS00573  PYRIDINE_REDOX_2  
Amino Acid Sequences MAPITNGDHIAVTEPKAKGEKSKKQHSQVVIIGSGPAGHTAAIYLARANLEPVLYEGMLANGFAPGGQLTTTTEVENFPGFPDGVTGTEMMDKFRAQSERFGTKIITETIARVDLTQRPFKFWTEGEEEEADFMTADTLIIATGASAKRLFLPGEETYWQSGISACAVCDGAVPIFRNKPLAVIGGGDSAAEEATYLTKYGSHVYVLVRRDELRASKIMAKRLVSHPKVTVLWNTVATECKGDGDLLQSLALKNVKTGEESELQVNGLFYAIGHEPATALVKSQLETDVDGYIKTVPGTAQTSVKGVFAAGDVQDKKYRQAITSAGSGCMAALEAERLISEEEAEDDSISAEDVHVPSEGYMGADKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.29
4 0.3
5 0.37
6 0.45
7 0.53
8 0.56
9 0.67
10 0.72
11 0.77
12 0.84
13 0.79
14 0.76
15 0.7
16 0.64
17 0.54
18 0.45
19 0.36
20 0.28
21 0.23
22 0.15
23 0.11
24 0.07
25 0.06
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.07
32 0.08
33 0.1
34 0.1
35 0.11
36 0.1
37 0.09
38 0.09
39 0.1
40 0.11
41 0.1
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.08
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.05
55 0.05
56 0.07
57 0.11
58 0.12
59 0.12
60 0.12
61 0.13
62 0.14
63 0.15
64 0.13
65 0.1
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.1
72 0.1
73 0.09
74 0.08
75 0.12
76 0.12
77 0.12
78 0.12
79 0.12
80 0.12
81 0.17
82 0.21
83 0.19
84 0.25
85 0.3
86 0.34
87 0.35
88 0.35
89 0.31
90 0.27
91 0.29
92 0.23
93 0.19
94 0.14
95 0.14
96 0.15
97 0.15
98 0.14
99 0.12
100 0.14
101 0.17
102 0.21
103 0.28
104 0.27
105 0.3
106 0.32
107 0.33
108 0.34
109 0.29
110 0.29
111 0.28
112 0.28
113 0.27
114 0.26
115 0.24
116 0.21
117 0.21
118 0.15
119 0.09
120 0.08
121 0.05
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.02
130 0.06
131 0.06
132 0.07
133 0.07
134 0.08
135 0.09
136 0.1
137 0.11
138 0.08
139 0.12
140 0.12
141 0.15
142 0.16
143 0.16
144 0.15
145 0.16
146 0.15
147 0.1
148 0.1
149 0.08
150 0.08
151 0.07
152 0.06
153 0.06
154 0.07
155 0.06
156 0.06
157 0.06
158 0.05
159 0.07
160 0.08
161 0.09
162 0.1
163 0.11
164 0.12
165 0.12
166 0.12
167 0.11
168 0.11
169 0.09
170 0.09
171 0.09
172 0.07
173 0.07
174 0.06
175 0.05
176 0.04
177 0.04
178 0.03
179 0.03
180 0.02
181 0.03
182 0.04
183 0.04
184 0.04
185 0.05
186 0.06
187 0.07
188 0.08
189 0.07
190 0.09
191 0.1
192 0.15
193 0.16
194 0.17
195 0.16
196 0.17
197 0.17
198 0.18
199 0.19
200 0.16
201 0.16
202 0.18
203 0.23
204 0.26
205 0.3
206 0.3
207 0.29
208 0.31
209 0.37
210 0.45
211 0.41
212 0.4
213 0.37
214 0.37
215 0.37
216 0.35
217 0.29
218 0.22
219 0.22
220 0.2
221 0.2
222 0.17
223 0.18
224 0.16
225 0.15
226 0.12
227 0.11
228 0.1
229 0.09
230 0.08
231 0.09
232 0.09
233 0.09
234 0.09
235 0.09
236 0.09
237 0.12
238 0.13
239 0.11
240 0.11
241 0.13
242 0.13
243 0.13
244 0.15
245 0.16
246 0.17
247 0.19
248 0.19
249 0.17
250 0.17
251 0.16
252 0.14
253 0.1
254 0.07
255 0.06
256 0.04
257 0.07
258 0.07
259 0.08
260 0.08
261 0.08
262 0.08
263 0.09
264 0.12
265 0.09
266 0.09
267 0.11
268 0.11
269 0.12
270 0.13
271 0.14
272 0.12
273 0.14
274 0.14
275 0.13
276 0.12
277 0.12
278 0.12
279 0.11
280 0.1
281 0.09
282 0.09
283 0.07
284 0.11
285 0.14
286 0.15
287 0.17
288 0.17
289 0.19
290 0.19
291 0.19
292 0.15
293 0.12
294 0.11
295 0.09
296 0.1
297 0.09
298 0.15
299 0.16
300 0.2
301 0.25
302 0.26
303 0.28
304 0.32
305 0.34
306 0.28
307 0.32
308 0.32
309 0.3
310 0.36
311 0.34
312 0.29
313 0.27
314 0.25
315 0.2
316 0.16
317 0.13
318 0.07
319 0.06
320 0.06
321 0.06
322 0.06
323 0.06
324 0.07
325 0.08
326 0.08
327 0.08
328 0.07
329 0.09
330 0.11
331 0.11
332 0.1
333 0.09
334 0.1
335 0.09
336 0.09
337 0.08
338 0.06
339 0.09
340 0.09
341 0.1
342 0.1
343 0.1
344 0.1
345 0.11
346 0.11
347 0.09