Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K1S6

Protein Details
Accession I2K1S6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-61RELSEKEKRDQKRKRRANNEVRQKEVBasic
NLS Segment(s)
PositionSequence
42-54KEKRDQKRKRRAN
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024576  rRNA_MeTfrase_Spb1_DUF3381  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF11861  DUF3381  
Amino Acid Sequences MLEKHLVXWKRKIKILDKSKIELEDLTEDQRIDKELRELSEKEKRDQKRKRRANNEVRQKEVRRMQMDMLSDMQIGIDAAENGSESMFSLKMAQKTGILKDIAXGKKSXXN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.72
4 0.7
5 0.65
6 0.58
7 0.52
8 0.41
9 0.34
10 0.29
11 0.25
12 0.23
13 0.2
14 0.18
15 0.18
16 0.18
17 0.17
18 0.13
19 0.13
20 0.15
21 0.16
22 0.18
23 0.22
24 0.23
25 0.26
26 0.34
27 0.35
28 0.36
29 0.42
30 0.47
31 0.54
32 0.63
33 0.67
34 0.7
35 0.78
36 0.83
37 0.85
38 0.89
39 0.89
40 0.89
41 0.9
42 0.83
43 0.78
44 0.74
45 0.66
46 0.62
47 0.57
48 0.55
49 0.46
50 0.43
51 0.4
52 0.36
53 0.36
54 0.3
55 0.25
56 0.18
57 0.16
58 0.14
59 0.12
60 0.08
61 0.07
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.06
73 0.06
74 0.06
75 0.11
76 0.15
77 0.17
78 0.2
79 0.2
80 0.23
81 0.26
82 0.29
83 0.29
84 0.26
85 0.24
86 0.3
87 0.37