Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6A4Z6

Protein Details
Accession A0A1A6A4Z6    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
26-55DYVHRARDYKSKQDRIKKLREKAAFRNKDEBasic
NLS Segment(s)
PositionSequence
14-17HRAK
23-25KHK
29-48HRARDYKSKQDRIKKLREKA
156-164KRKGKAKAK
302-318KKRFEGKMWKWKLERRR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MARRNHKERSQPAHRAKLGLLEKHKDYVHRARDYKSKQDRIKKLREKAAFRNKDEFYWGMIKGQTKGGVAIADRGHKALDTDVVKILKSQDLGYVRVQIAKDEKKIRDLRTSLEISSSLAGPSRSTAEEWDAMAELAEVEKLAEMGIIIKPQEGVKRKGKAKAKEGHVIFAEGKDEFEKFGESSGTQADNSDIRKEEETIDLGWAEPISSKKKGKSKAIQNQSTLVDVEEDADELAEEARENRMEHLTLLSAYLARLKLLRQAESKLEITKGLMGKGGVAKRVREDRYVEDENAPEDENGEKKRFEGKMWKWKLERRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.72
3 0.63
4 0.62
5 0.58
6 0.56
7 0.53
8 0.49
9 0.48
10 0.51
11 0.52
12 0.46
13 0.47
14 0.49
15 0.51
16 0.55
17 0.57
18 0.57
19 0.65
20 0.69
21 0.71
22 0.72
23 0.73
24 0.72
25 0.79
26 0.85
27 0.84
28 0.89
29 0.88
30 0.86
31 0.86
32 0.85
33 0.83
34 0.83
35 0.84
36 0.82
37 0.77
38 0.76
39 0.68
40 0.6
41 0.57
42 0.47
43 0.4
44 0.35
45 0.3
46 0.25
47 0.26
48 0.27
49 0.24
50 0.26
51 0.23
52 0.19
53 0.2
54 0.18
55 0.16
56 0.15
57 0.17
58 0.17
59 0.18
60 0.18
61 0.18
62 0.17
63 0.15
64 0.16
65 0.12
66 0.16
67 0.14
68 0.15
69 0.19
70 0.19
71 0.19
72 0.2
73 0.2
74 0.16
75 0.16
76 0.15
77 0.17
78 0.18
79 0.21
80 0.21
81 0.24
82 0.22
83 0.24
84 0.24
85 0.2
86 0.25
87 0.27
88 0.33
89 0.36
90 0.37
91 0.42
92 0.49
93 0.5
94 0.51
95 0.48
96 0.44
97 0.44
98 0.44
99 0.36
100 0.31
101 0.27
102 0.2
103 0.19
104 0.16
105 0.09
106 0.09
107 0.08
108 0.07
109 0.08
110 0.09
111 0.09
112 0.09
113 0.1
114 0.11
115 0.12
116 0.12
117 0.12
118 0.1
119 0.09
120 0.08
121 0.07
122 0.05
123 0.04
124 0.03
125 0.03
126 0.02
127 0.02
128 0.03
129 0.02
130 0.02
131 0.02
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.06
138 0.07
139 0.13
140 0.16
141 0.22
142 0.28
143 0.35
144 0.39
145 0.46
146 0.53
147 0.53
148 0.58
149 0.6
150 0.58
151 0.58
152 0.55
153 0.5
154 0.43
155 0.38
156 0.3
157 0.22
158 0.18
159 0.1
160 0.1
161 0.08
162 0.08
163 0.07
164 0.07
165 0.07
166 0.06
167 0.07
168 0.08
169 0.07
170 0.08
171 0.09
172 0.1
173 0.08
174 0.09
175 0.09
176 0.11
177 0.12
178 0.13
179 0.13
180 0.14
181 0.15
182 0.15
183 0.16
184 0.15
185 0.15
186 0.13
187 0.13
188 0.11
189 0.1
190 0.09
191 0.08
192 0.06
193 0.07
194 0.09
195 0.13
196 0.19
197 0.22
198 0.29
199 0.36
200 0.44
201 0.52
202 0.58
203 0.65
204 0.7
205 0.77
206 0.76
207 0.71
208 0.67
209 0.58
210 0.5
211 0.39
212 0.29
213 0.19
214 0.13
215 0.12
216 0.08
217 0.08
218 0.06
219 0.06
220 0.05
221 0.05
222 0.05
223 0.04
224 0.04
225 0.05
226 0.07
227 0.09
228 0.09
229 0.11
230 0.14
231 0.14
232 0.14
233 0.15
234 0.14
235 0.12
236 0.12
237 0.11
238 0.09
239 0.08
240 0.12
241 0.1
242 0.1
243 0.11
244 0.11
245 0.18
246 0.21
247 0.26
248 0.25
249 0.28
250 0.32
251 0.36
252 0.37
253 0.32
254 0.3
255 0.26
256 0.24
257 0.26
258 0.23
259 0.19
260 0.18
261 0.16
262 0.18
263 0.24
264 0.25
265 0.26
266 0.27
267 0.28
268 0.34
269 0.43
270 0.43
271 0.42
272 0.44
273 0.45
274 0.5
275 0.53
276 0.49
277 0.43
278 0.42
279 0.38
280 0.36
281 0.3
282 0.21
283 0.17
284 0.18
285 0.21
286 0.24
287 0.26
288 0.24
289 0.25
290 0.34
291 0.35
292 0.38
293 0.43
294 0.49
295 0.57
296 0.65
297 0.72
298 0.71