Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A5ZYZ8

Protein Details
Accession A0A1A5ZYZ8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKSPWRLSPTRKANQRKRLKQVDSVHydrophilic
74-97TTFSKHHRGYRKSQHKVPKWTRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRQSSISFGGLLWKSPWRLSPTRKANQRKRLKQVDSVIAAVAESGIITRSLEKALALPMESEMAAKNKYTTFSKHHRGYRKSQHKVPKWTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.21
5 0.22
6 0.23
7 0.28
8 0.27
9 0.35
10 0.41
11 0.49
12 0.55
13 0.62
14 0.71
15 0.77
16 0.8
17 0.83
18 0.87
19 0.86
20 0.86
21 0.87
22 0.81
23 0.78
24 0.73
25 0.69
26 0.6
27 0.51
28 0.41
29 0.3
30 0.26
31 0.18
32 0.12
33 0.05
34 0.03
35 0.02
36 0.02
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.06
53 0.06
54 0.08
55 0.08
56 0.08
57 0.1
58 0.1
59 0.14
60 0.16
61 0.19
62 0.24
63 0.33
64 0.42
65 0.48
66 0.56
67 0.63
68 0.66
69 0.72
70 0.76
71 0.79
72 0.78
73 0.79
74 0.81
75 0.81
76 0.86
77 0.85
78 0.85
79 0.8
80 0.8
81 0.8
82 0.78
83 0.77
84 0.75
85 0.76