Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A6AAL6

Protein Details
Accession A0A1A6AAL6   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-28SSSPQSPKSRKAKAINEDPAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021660  DUF3253  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF11625  DUF3253  
Amino Acid Sequences MPKDLSSSSSPQSPKSRKAKAINEDPAQAQVHAQAYLSTLHHLLSRTSEGSTICPSQIPRALNKENPERYPDWRALMDPVREVVWDQVRRGIVEVTQKGEVREYKSRGEIRGPIRVRKGPKWDERDTLPSSTGDPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.66
4 0.69
5 0.77
6 0.79
7 0.78
8 0.81
9 0.8
10 0.73
11 0.67
12 0.58
13 0.52
14 0.44
15 0.34
16 0.24
17 0.19
18 0.17
19 0.14
20 0.14
21 0.1
22 0.1
23 0.12
24 0.12
25 0.1
26 0.09
27 0.09
28 0.11
29 0.12
30 0.11
31 0.12
32 0.14
33 0.13
34 0.13
35 0.15
36 0.13
37 0.14
38 0.17
39 0.15
40 0.13
41 0.13
42 0.14
43 0.15
44 0.19
45 0.18
46 0.19
47 0.25
48 0.28
49 0.3
50 0.34
51 0.4
52 0.39
53 0.39
54 0.4
55 0.35
56 0.36
57 0.37
58 0.33
59 0.27
60 0.24
61 0.23
62 0.22
63 0.24
64 0.21
65 0.18
66 0.17
67 0.15
68 0.14
69 0.14
70 0.14
71 0.17
72 0.18
73 0.18
74 0.21
75 0.22
76 0.22
77 0.23
78 0.19
79 0.15
80 0.21
81 0.22
82 0.2
83 0.23
84 0.24
85 0.23
86 0.27
87 0.27
88 0.26
89 0.32
90 0.33
91 0.33
92 0.4
93 0.43
94 0.41
95 0.43
96 0.44
97 0.41
98 0.47
99 0.48
100 0.47
101 0.51
102 0.55
103 0.58
104 0.58
105 0.64
106 0.64
107 0.69
108 0.71
109 0.7
110 0.69
111 0.67
112 0.67
113 0.61
114 0.54
115 0.45
116 0.38
117 0.34