Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JU32

Protein Details
Accession I2JU32    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSEKSRPKNKHFWVKPKTETPAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, mito 8, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024909  Cys-tRNA/MSH_ligase  
IPR014729  Rossmann-like_a/b/a_fold  
IPR032678  tRNA-synt_1_cat_dom  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF01406  tRNA-synt_1e  
Amino Acid Sequences MSEKSRPKNKHFWVKPKTETPADEPVLKLYNTLTHXKVEFVPIKPHEVKWYSCGPTVYNVSHMGHARNYVTIDINRXILQDYFNYDVTFVQNVTDIDDKIILKAREEYLLKNYXEKQSXKITXEYVEKVKEGLGKYIAKNLPDYXGPXLDYGGVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.82
4 0.78
5 0.72
6 0.66
7 0.61
8 0.6
9 0.53
10 0.48
11 0.4
12 0.36
13 0.34
14 0.3
15 0.24
16 0.16
17 0.21
18 0.22
19 0.25
20 0.24
21 0.22
22 0.23
23 0.23
24 0.28
25 0.23
26 0.22
27 0.26
28 0.25
29 0.31
30 0.32
31 0.33
32 0.34
33 0.35
34 0.34
35 0.3
36 0.36
37 0.31
38 0.32
39 0.32
40 0.25
41 0.26
42 0.28
43 0.25
44 0.2
45 0.2
46 0.18
47 0.2
48 0.2
49 0.18
50 0.15
51 0.16
52 0.14
53 0.13
54 0.12
55 0.11
56 0.11
57 0.1
58 0.12
59 0.11
60 0.12
61 0.11
62 0.11
63 0.1
64 0.08
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.08
75 0.07
76 0.08
77 0.08
78 0.1
79 0.11
80 0.1
81 0.1
82 0.12
83 0.12
84 0.11
85 0.17
86 0.14
87 0.14
88 0.17
89 0.18
90 0.21
91 0.22
92 0.23
93 0.23
94 0.3
95 0.29
96 0.32
97 0.36
98 0.39
99 0.4
100 0.4
101 0.4
102 0.39
103 0.42
104 0.4
105 0.42
106 0.38
107 0.45
108 0.45
109 0.4
110 0.36
111 0.34
112 0.35
113 0.3
114 0.29
115 0.25
116 0.28
117 0.28
118 0.37
119 0.37
120 0.34
121 0.35
122 0.33
123 0.3
124 0.28
125 0.29
126 0.23
127 0.22
128 0.21