Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A6ABA1

Protein Details
Accession A0A1A6ABA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29SSFTDCKGKACKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSSFTDCKGKACKKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKHQLSLKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.8
4 0.82
5 0.84
6 0.87
7 0.84
8 0.85
9 0.85
10 0.8
11 0.76
12 0.71
13 0.62
14 0.56
15 0.53
16 0.52
17 0.52
18 0.5
19 0.5
20 0.51
21 0.54
22 0.57
23 0.58
24 0.54
25 0.54
26 0.59
27 0.6
28 0.62
29 0.6
30 0.59
31 0.59
32 0.6
33 0.51
34 0.46
35 0.42
36 0.35
37 0.36
38 0.37
39 0.35
40 0.3
41 0.36
42 0.4
43 0.49
44 0.57
45 0.6
46 0.6
47 0.63
48 0.7
49 0.71
50 0.7
51 0.66
52 0.61
53 0.58
54 0.57
55 0.51
56 0.47
57 0.45
58 0.39
59 0.37
60 0.39
61 0.39
62 0.43
63 0.51
64 0.55
65 0.58
66 0.69
67 0.73
68 0.76
69 0.73
70 0.68
71 0.63
72 0.57
73 0.55
74 0.55
75 0.55
76 0.55
77 0.62
78 0.59
79 0.56
80 0.56
81 0.5