Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JX80

Protein Details
Accession I2JX80    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTVLKRGRKKRKKEEDAPLLKDABasic
NLS Segment(s)
PositionSequence
5-13KRGRKKRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024325  DUF3835  
Pfam View protein in Pfam  
PF12927  DUF3835  
Amino Acid Sequences MTVLKRGRKKRKKEEDAPLLKDAVVEHDPSEMADHAEDDLDVELNSDNLNRQVSLDYARMRERMMHKYNGGFGKTKKEREFEPLDEEPHVSRFKAARLGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.91
4 0.85
5 0.76
6 0.65
7 0.54
8 0.44
9 0.33
10 0.27
11 0.19
12 0.15
13 0.13
14 0.13
15 0.13
16 0.12
17 0.13
18 0.09
19 0.08
20 0.07
21 0.07
22 0.06
23 0.07
24 0.06
25 0.05
26 0.05
27 0.05
28 0.04
29 0.05
30 0.04
31 0.04
32 0.05
33 0.04
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.1
42 0.13
43 0.13
44 0.15
45 0.17
46 0.17
47 0.17
48 0.22
49 0.24
50 0.3
51 0.33
52 0.35
53 0.35
54 0.36
55 0.41
56 0.4
57 0.37
58 0.32
59 0.29
60 0.36
61 0.41
62 0.47
63 0.46
64 0.45
65 0.45
66 0.49
67 0.55
68 0.47
69 0.48
70 0.43
71 0.41
72 0.39
73 0.38
74 0.32
75 0.29
76 0.28
77 0.2
78 0.22
79 0.22
80 0.24