Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JV00

Protein Details
Accession I2JV00    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-140KADGETKKTAKKRERPAGVSRVSHydrophilic
NLS Segment(s)
PositionSequence
124-133KKTAKKREXR
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009772  CDC123  
Pfam View protein in Pfam  
PF07065  D123  
Amino Acid Sequences MPESTTESEAATFSDISVSTQDIENCIYSHWYEKFSQYTYTKATILKPVPKEFISYLEADDIVLPKDEDSKPMALFQDVVPNEDNDYSDWEEEDEAEEGKDGDKKDQNIKKTACDEHKADGETKKTAKKREXRPAXGVSRVSQQRLXPPXXT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.11
5 0.11
6 0.1
7 0.12
8 0.12
9 0.12
10 0.13
11 0.13
12 0.12
13 0.12
14 0.13
15 0.12
16 0.17
17 0.17
18 0.19
19 0.2
20 0.23
21 0.26
22 0.26
23 0.32
24 0.28
25 0.3
26 0.3
27 0.31
28 0.29
29 0.28
30 0.28
31 0.28
32 0.32
33 0.35
34 0.36
35 0.37
36 0.38
37 0.37
38 0.37
39 0.31
40 0.29
41 0.25
42 0.21
43 0.18
44 0.15
45 0.15
46 0.12
47 0.12
48 0.08
49 0.06
50 0.06
51 0.05
52 0.05
53 0.1
54 0.1
55 0.11
56 0.12
57 0.13
58 0.13
59 0.15
60 0.15
61 0.11
62 0.11
63 0.1
64 0.15
65 0.14
66 0.15
67 0.14
68 0.14
69 0.15
70 0.14
71 0.14
72 0.08
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.09
79 0.09
80 0.1
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.1
88 0.09
89 0.14
90 0.18
91 0.22
92 0.32
93 0.37
94 0.41
95 0.47
96 0.48
97 0.49
98 0.5
99 0.55
100 0.51
101 0.51
102 0.49
103 0.45
104 0.48
105 0.44
106 0.42
107 0.39
108 0.36
109 0.37
110 0.39
111 0.43
112 0.45
113 0.53
114 0.6
115 0.64
116 0.72
117 0.77
118 0.82
119 0.8
120 0.82
121 0.82
122 0.76
123 0.71
124 0.68
125 0.67
126 0.6
127 0.57