Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K1P4

Protein Details
Accession I2K1P4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
99-118PDSVEEKKKKEKKPEKLLSLBasic
NLS Segment(s)
PositionSequence
106-114KKXKKEKKP
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009027  Ribosomal_L9/RNase_H1_N  
IPR036935  Ribosomal_L9_N_sf  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Amino Acid Sequences MRSEGRKFGVRYTAQSKKKRIAVQLLDSFAGIGITGQIVHVKASTMMNKLHRGNGAVYLNYEGAKPRITVIDPKKIQARRMKELRAANIKPEQIVAEGPDXSVEEKKXKKEKKPEKLLSLDELIXLDLAEVSEEDRDKVVDAMPKKITLKRYTKDGAIDPALSXPKIASSLENIVRKSLGHKKLQDAVSQFFNQEKIKLVLRPAAVQDEXXEVANXIXSIKKTGSYTLSVEENGXQLXEIIIRVVDREH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.69
4 0.68
5 0.73
6 0.73
7 0.72
8 0.73
9 0.71
10 0.71
11 0.69
12 0.63
13 0.55
14 0.48
15 0.4
16 0.3
17 0.22
18 0.12
19 0.06
20 0.04
21 0.04
22 0.04
23 0.04
24 0.06
25 0.06
26 0.07
27 0.07
28 0.07
29 0.09
30 0.12
31 0.16
32 0.17
33 0.22
34 0.26
35 0.32
36 0.33
37 0.35
38 0.33
39 0.32
40 0.3
41 0.32
42 0.3
43 0.24
44 0.23
45 0.21
46 0.2
47 0.18
48 0.17
49 0.12
50 0.11
51 0.12
52 0.12
53 0.11
54 0.13
55 0.14
56 0.23
57 0.27
58 0.36
59 0.36
60 0.38
61 0.45
62 0.45
63 0.51
64 0.5
65 0.52
66 0.51
67 0.57
68 0.59
69 0.58
70 0.59
71 0.59
72 0.6
73 0.53
74 0.49
75 0.46
76 0.42
77 0.36
78 0.31
79 0.25
80 0.16
81 0.16
82 0.12
83 0.09
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.15
90 0.16
91 0.18
92 0.28
93 0.37
94 0.43
95 0.53
96 0.63
97 0.67
98 0.76
99 0.82
100 0.78
101 0.74
102 0.69
103 0.6
104 0.51
105 0.4
106 0.29
107 0.2
108 0.14
109 0.09
110 0.07
111 0.04
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.06
123 0.08
124 0.11
125 0.12
126 0.17
127 0.18
128 0.2
129 0.22
130 0.25
131 0.29
132 0.34
133 0.41
134 0.38
135 0.44
136 0.44
137 0.44
138 0.43
139 0.39
140 0.35
141 0.28
142 0.27
143 0.2
144 0.22
145 0.2
146 0.17
147 0.14
148 0.1
149 0.11
150 0.1
151 0.11
152 0.09
153 0.16
154 0.22
155 0.26
156 0.26
157 0.25
158 0.24
159 0.24
160 0.28
161 0.31
162 0.33
163 0.36
164 0.4
165 0.44
166 0.51
167 0.53
168 0.51
169 0.45
170 0.41
171 0.38
172 0.36
173 0.32
174 0.25
175 0.27
176 0.24
177 0.21
178 0.22
179 0.2
180 0.23
181 0.24
182 0.25
183 0.27
184 0.27
185 0.28
186 0.27
187 0.28
188 0.25
189 0.23
190 0.22
191 0.18
192 0.17
193 0.16
194 0.14
195 0.1
196 0.11
197 0.11
198 0.13
199 0.12
200 0.12
201 0.12
202 0.15
203 0.17
204 0.2
205 0.21
206 0.21
207 0.24
208 0.23
209 0.23
210 0.22
211 0.2
212 0.17
213 0.15
214 0.12
215 0.1
216 0.1
217 0.09
218 0.07
219 0.06