Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JX51

Protein Details
Accession I2JX51   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MFRFKFKFKFNFKFKFKFKFKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MFRFKFKFKFNFKFKFKFKFKFKIQIQIQVQIQXIRSNCSNSSSNQKWSNSNSQIQICIPMWIGKPPNXXXNQASIFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.8
4 0.79
5 0.78
6 0.78
7 0.77
8 0.78
9 0.73
10 0.73
11 0.67
12 0.67
13 0.6
14 0.56
15 0.5
16 0.46
17 0.44
18 0.35
19 0.35
20 0.27
21 0.27
22 0.23
23 0.23
24 0.17
25 0.19
26 0.2
27 0.18
28 0.26
29 0.26
30 0.31
31 0.35
32 0.37
33 0.38
34 0.41
35 0.49
36 0.44
37 0.46
38 0.44
39 0.4
40 0.4
41 0.36
42 0.35
43 0.26
44 0.23
45 0.19
46 0.18
47 0.18
48 0.22
49 0.27
50 0.28
51 0.35
52 0.4
53 0.46
54 0.45