Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JWP2

Protein Details
Accession I2JWP2   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-42WATSRNKNTKLVRMQRQQPRQAQVGHydrophilic
202-225ASPAATPPTRRRRKPRARKGAGAAHydrophilic
NLS Segment(s)
PositionSequence
225-241PTRRRRKPRARKGXAGA
290-291RR
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 4
Family & Domain DBs
Amino Acid Sequences MQIWTFSRGSRTRSRDFWATSRNKNTKLVRMQRQQPRXQAQVGLGMPNSAAXTRVXPAVVSQQFXELAEQRXQPXDEGDGXNQNQNLNLSQGQNLXXNLNQNFNPNLNQXMNAXQGQAQNXNLGANQSLNLXQNQNSNLNPSXNLNQNLNPNLNQNLTLAQNHPSVAQQRRMQQFTARSLQPQYLNQGAASPLSAGTPMAXTPLGSSPGALGAMGIASPXAATPPTRRRRKPRARKGXAGAAGXAGXXQGPPAAAAAAASAEAQALMKENAEHVAXVGARAVXADKERARRRRLAAHDXGRYLLATLADSLNLPEQERRVEQEKKXGSANANSANGNPNSVSNPSNTKTKSADSASPGSSILTPSAVLATPLAFNVKTPLPARLYDTPKMGATGALAVAALGAAAGRSHWTGKVRSACVSGAFEGIVGDVPRDLERKRLVGKDLIGLVYPTPPDDDASATSKRRKLSGSDVGNALATPTPLKSEGDAPDLRLDLDKFWDFDRX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.63
4 0.64
5 0.64
6 0.65
7 0.68
8 0.74
9 0.76
10 0.72
11 0.75
12 0.74
13 0.73
14 0.75
15 0.76
16 0.76
17 0.77
18 0.83
19 0.84
20 0.88
21 0.88
22 0.85
23 0.81
24 0.76
25 0.68
26 0.59
27 0.52
28 0.47
29 0.4
30 0.32
31 0.26
32 0.2
33 0.19
34 0.19
35 0.16
36 0.11
37 0.09
38 0.11
39 0.11
40 0.12
41 0.12
42 0.15
43 0.19
44 0.21
45 0.2
46 0.2
47 0.19
48 0.19
49 0.22
50 0.2
51 0.21
52 0.2
53 0.21
54 0.21
55 0.22
56 0.22
57 0.21
58 0.21
59 0.24
60 0.27
61 0.29
62 0.3
63 0.31
64 0.29
65 0.28
66 0.27
67 0.21
68 0.2
69 0.17
70 0.18
71 0.19
72 0.2
73 0.23
74 0.24
75 0.28
76 0.27
77 0.29
78 0.26
79 0.3
80 0.3
81 0.27
82 0.29
83 0.23
84 0.24
85 0.22
86 0.23
87 0.19
88 0.21
89 0.21
90 0.19
91 0.2
92 0.19
93 0.2
94 0.19
95 0.2
96 0.16
97 0.16
98 0.16
99 0.13
100 0.12
101 0.1
102 0.12
103 0.13
104 0.14
105 0.16
106 0.17
107 0.18
108 0.2
109 0.24
110 0.22
111 0.24
112 0.24
113 0.24
114 0.24
115 0.23
116 0.3
117 0.29
118 0.3
119 0.26
120 0.3
121 0.32
122 0.34
123 0.34
124 0.28
125 0.28
126 0.26
127 0.25
128 0.2
129 0.18
130 0.16
131 0.17
132 0.15
133 0.16
134 0.16
135 0.16
136 0.16
137 0.16
138 0.22
139 0.25
140 0.31
141 0.32
142 0.38
143 0.45
144 0.47
145 0.45
146 0.44
147 0.45
148 0.43
149 0.45
150 0.38
151 0.34
152 0.34
153 0.36
154 0.34
155 0.3
156 0.28
157 0.24
158 0.23
159 0.21
160 0.2
161 0.16
162 0.14
163 0.12
164 0.08
165 0.06
166 0.06
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.07
182 0.07
183 0.06
184 0.03
185 0.03
186 0.03
187 0.03
188 0.02
189 0.02
190 0.02
191 0.02
192 0.04
193 0.04
194 0.07
195 0.17
196 0.28
197 0.37
198 0.45
199 0.55
200 0.65
201 0.77
202 0.86
203 0.88
204 0.88
205 0.86
206 0.84
207 0.79
208 0.74
209 0.65
210 0.54
211 0.43
212 0.32
213 0.26
214 0.19
215 0.14
216 0.07
217 0.05
218 0.04
219 0.04
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.03
226 0.03
227 0.03
228 0.02
229 0.03
230 0.03
231 0.03
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.06
238 0.06
239 0.05
240 0.04
241 0.06
242 0.05
243 0.05
244 0.05
245 0.04
246 0.04
247 0.05
248 0.05
249 0.08
250 0.11
251 0.19
252 0.29
253 0.35
254 0.39
255 0.45
256 0.49
257 0.54
258 0.58
259 0.61
260 0.6
261 0.6
262 0.6
263 0.55
264 0.51
265 0.42
266 0.35
267 0.25
268 0.16
269 0.1
270 0.07
271 0.06
272 0.06
273 0.05
274 0.05
275 0.07
276 0.07
277 0.08
278 0.09
279 0.1
280 0.12
281 0.13
282 0.16
283 0.21
284 0.26
285 0.28
286 0.35
287 0.38
288 0.38
289 0.4
290 0.4
291 0.35
292 0.35
293 0.35
294 0.29
295 0.26
296 0.25
297 0.27
298 0.23
299 0.23
300 0.17
301 0.16
302 0.15
303 0.16
304 0.16
305 0.13
306 0.19
307 0.2
308 0.27
309 0.27
310 0.28
311 0.29
312 0.3
313 0.33
314 0.31
315 0.33
316 0.3
317 0.33
318 0.31
319 0.29
320 0.27
321 0.23
322 0.2
323 0.16
324 0.12
325 0.09
326 0.08
327 0.07
328 0.08
329 0.07
330 0.07
331 0.06
332 0.06
333 0.06
334 0.07
335 0.08
336 0.07
337 0.07
338 0.1
339 0.11
340 0.15
341 0.16
342 0.2
343 0.21
344 0.22
345 0.28
346 0.33
347 0.38
348 0.37
349 0.39
350 0.36
351 0.33
352 0.33
353 0.28
354 0.19
355 0.14
356 0.12
357 0.09
358 0.07
359 0.07
360 0.05
361 0.05
362 0.04
363 0.04
364 0.02
365 0.02
366 0.02
367 0.02
368 0.02
369 0.04
370 0.06
371 0.07
372 0.11
373 0.15
374 0.18
375 0.25
376 0.33
377 0.34
378 0.35
379 0.36
380 0.34
381 0.33
382 0.33
383 0.26
384 0.2
385 0.17
386 0.14
387 0.12
388 0.11
389 0.1
390 0.07
391 0.07
392 0.06
393 0.08
394 0.1
395 0.13
396 0.13
397 0.19
398 0.23
399 0.29
400 0.35
401 0.38
402 0.4
403 0.42
404 0.44
405 0.41
406 0.4
407 0.35
408 0.29
409 0.25
410 0.22
411 0.19
412 0.17
413 0.13
414 0.12
415 0.12
416 0.13
417 0.13
418 0.15
419 0.16
420 0.2
421 0.26
422 0.3
423 0.37
424 0.4
425 0.41
426 0.43
427 0.43
428 0.44
429 0.48
430 0.52
431 0.51
432 0.51
433 0.5
434 0.47
435 0.43
436 0.37
437 0.29
438 0.2
439 0.14
440 0.11
441 0.1
442 0.13
443 0.14
444 0.16
445 0.16
446 0.22
447 0.24
448 0.3
449 0.31
450 0.3
451 0.32
452 0.31
453 0.3
454 0.27
455 0.25
456 0.2
457 0.25
458 0.25