Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JS45

Protein Details
Accession I2JS45   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-43DEMIKMLRKAVRKKRKRREVSDSGSEEBasic
86-110TSKVVTNSHKGPKKKKDNLEFDSITHydrophilic
NLS Segment(s)
PositionSequence
20-34IKMLRKAVRKKRKRR
99-103GPKKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MLEDLGRKRNEIEKQKDEMIKMLRKAVRKKRKRREVSDSGSEEEEEEEDDDYDFXAGSKSRDYDKDNIDLSSDSDSISEFEXEKSPKXTSKVVTNSHKGPKKKKDNLEFDSIXTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.65
4 0.58
5 0.55
6 0.52
7 0.49
8 0.44
9 0.47
10 0.44
11 0.48
12 0.57
13 0.62
14 0.65
15 0.7
16 0.79
17 0.82
18 0.89
19 0.92
20 0.91
21 0.89
22 0.89
23 0.85
24 0.83
25 0.74
26 0.65
27 0.55
28 0.46
29 0.36
30 0.26
31 0.19
32 0.1
33 0.08
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.06
43 0.06
44 0.07
45 0.09
46 0.12
47 0.15
48 0.18
49 0.23
50 0.23
51 0.28
52 0.28
53 0.26
54 0.24
55 0.22
56 0.19
57 0.17
58 0.15
59 0.1
60 0.09
61 0.1
62 0.09
63 0.1
64 0.11
65 0.08
66 0.1
67 0.15
68 0.16
69 0.2
70 0.24
71 0.23
72 0.25
73 0.3
74 0.34
75 0.38
76 0.47
77 0.49
78 0.53
79 0.59
80 0.66
81 0.68
82 0.71
83 0.72
84 0.74
85 0.79
86 0.81
87 0.84
88 0.85
89 0.88
90 0.85
91 0.84