Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JU87

Protein Details
Accession I2JU87    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
175-202KMPIEETLKRRRDRKRGTVDLNKRPSTNHydrophilic
NLS Segment(s)
PositionSequence
183-190KRRRDRKR
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd01860  Rab5_related  
Amino Acid Sequences MSTDIASDEHKFVQFKLVLLGESAVGKSSIVQRFVKDSFNDFKESTIGAAFLTQTIDLDSDTTVKFEIWDTAGQERYRSLASIYYRNAQSALVVYDITQKASLDKAKYWIKELQKQASNNIVIALVGNKTDLEEERQIPTEEAQAFANEAGLLFFEVSAKSGKGIKDCFREIALKMPIEETLKRRRDRKRGTVDLNKRPSTNEQQCAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.26
4 0.25
5 0.22
6 0.21
7 0.21
8 0.14
9 0.13
10 0.13
11 0.09
12 0.08
13 0.08
14 0.09
15 0.16
16 0.2
17 0.23
18 0.25
19 0.26
20 0.31
21 0.33
22 0.36
23 0.3
24 0.32
25 0.34
26 0.35
27 0.38
28 0.33
29 0.32
30 0.28
31 0.27
32 0.22
33 0.15
34 0.13
35 0.08
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.08
54 0.09
55 0.08
56 0.1
57 0.11
58 0.14
59 0.18
60 0.18
61 0.17
62 0.16
63 0.16
64 0.15
65 0.14
66 0.11
67 0.12
68 0.15
69 0.19
70 0.2
71 0.24
72 0.23
73 0.23
74 0.23
75 0.18
76 0.16
77 0.12
78 0.11
79 0.07
80 0.06
81 0.06
82 0.11
83 0.12
84 0.12
85 0.11
86 0.1
87 0.1
88 0.13
89 0.15
90 0.11
91 0.12
92 0.18
93 0.22
94 0.23
95 0.25
96 0.29
97 0.31
98 0.37
99 0.42
100 0.42
101 0.43
102 0.44
103 0.43
104 0.42
105 0.37
106 0.3
107 0.25
108 0.18
109 0.13
110 0.12
111 0.1
112 0.05
113 0.05
114 0.05
115 0.04
116 0.05
117 0.06
118 0.06
119 0.1
120 0.13
121 0.14
122 0.16
123 0.18
124 0.19
125 0.18
126 0.18
127 0.19
128 0.16
129 0.16
130 0.14
131 0.13
132 0.12
133 0.12
134 0.11
135 0.06
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.06
145 0.07
146 0.07
147 0.08
148 0.12
149 0.13
150 0.18
151 0.24
152 0.29
153 0.35
154 0.37
155 0.37
156 0.36
157 0.38
158 0.34
159 0.36
160 0.34
161 0.29
162 0.27
163 0.26
164 0.26
165 0.27
166 0.3
167 0.28
168 0.34
169 0.41
170 0.47
171 0.56
172 0.64
173 0.71
174 0.77
175 0.82
176 0.83
177 0.85
178 0.88
179 0.9
180 0.9
181 0.9
182 0.89
183 0.82
184 0.72
185 0.66
186 0.64
187 0.64
188 0.63