Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JTN5

Protein Details
Accession I2JTN5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-37LKRGKKVAKSVHSKSRREKGBasic
NLS Segment(s)
PositionSequence
5-38KGKVGXKGRSGRPELKXRGKKVAKSVHSKSRREK
Subcellular Location(s) nucl 17, mito_nucl 11.833, cyto_nucl 10.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007128  PMF1/Nnf1  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF03980  Nnf1  
Amino Acid Sequences MASGKGKVGXKGRSGRPELKXRGKKVAKSVHSKSRREKGGVEYVRFNGLEKAAEFALSETLRKLTLQRMEECYPDIEPEVLEYIRKQTIEVWRKKAEAECGQIYTERDLKSKLDALDEIVSDARDRQSRRDPDVLHMDRVKPEEVVQSQLIALKEQAIRKXTKSLNSLRYHKKILLRELERVSXGVEXGCEELDGVVGELGDLNSSQKEPDDGQFEKLIEYAVDGGRAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.74
4 0.77
5 0.8
6 0.79
7 0.79
8 0.79
9 0.77
10 0.8
11 0.79
12 0.78
13 0.78
14 0.77
15 0.8
16 0.79
17 0.8
18 0.8
19 0.8
20 0.77
21 0.71
22 0.67
23 0.63
24 0.65
25 0.63
26 0.57
27 0.51
28 0.46
29 0.45
30 0.41
31 0.35
32 0.26
33 0.2
34 0.19
35 0.15
36 0.16
37 0.13
38 0.13
39 0.12
40 0.1
41 0.13
42 0.12
43 0.12
44 0.11
45 0.11
46 0.12
47 0.12
48 0.13
49 0.15
50 0.22
51 0.26
52 0.29
53 0.34
54 0.36
55 0.36
56 0.36
57 0.3
58 0.24
59 0.21
60 0.17
61 0.11
62 0.09
63 0.09
64 0.1
65 0.08
66 0.09
67 0.08
68 0.1
69 0.12
70 0.12
71 0.12
72 0.14
73 0.25
74 0.34
75 0.4
76 0.43
77 0.44
78 0.45
79 0.46
80 0.44
81 0.4
82 0.35
83 0.34
84 0.29
85 0.27
86 0.27
87 0.27
88 0.25
89 0.21
90 0.2
91 0.16
92 0.16
93 0.16
94 0.16
95 0.17
96 0.19
97 0.17
98 0.14
99 0.13
100 0.14
101 0.14
102 0.13
103 0.12
104 0.09
105 0.08
106 0.07
107 0.08
108 0.08
109 0.11
110 0.12
111 0.17
112 0.26
113 0.31
114 0.36
115 0.41
116 0.4
117 0.41
118 0.51
119 0.47
120 0.42
121 0.39
122 0.35
123 0.31
124 0.32
125 0.28
126 0.18
127 0.17
128 0.19
129 0.17
130 0.2
131 0.18
132 0.16
133 0.15
134 0.18
135 0.17
136 0.12
137 0.11
138 0.12
139 0.15
140 0.17
141 0.23
142 0.26
143 0.28
144 0.29
145 0.36
146 0.35
147 0.42
148 0.47
149 0.49
150 0.5
151 0.58
152 0.65
153 0.64
154 0.65
155 0.59
156 0.59
157 0.57
158 0.59
159 0.58
160 0.53
161 0.55
162 0.53
163 0.51
164 0.44
165 0.38
166 0.32
167 0.23
168 0.2
169 0.14
170 0.11
171 0.1
172 0.09
173 0.09
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.04
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.07
187 0.08
188 0.08
189 0.09
190 0.12
191 0.14
192 0.18
193 0.24
194 0.24
195 0.27
196 0.3
197 0.29
198 0.27
199 0.25
200 0.21
201 0.14
202 0.14
203 0.14
204 0.11
205 0.11