Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K2T9

Protein Details
Accession I2K2T9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAPRLTPKIVKKNTKKFKRHQSDRFKRVDENHydrophilic
NLS Segment(s)
PositionSequence
9-27IVKKNTKKFKRHQSDRFKR
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPRLTPKIVKKNTKKFKRHQSDRFKRVDENWRLQKGIDSRIRRRFRGTVYAPKIGYGSNKKTKFLNVHGQKVITVRNIKELDALLMNNKLYAAEIAHNVSAKHRVTLLARAKAIGVKVTNPKGRLTLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.92
5 0.92
6 0.92
7 0.92
8 0.92
9 0.93
10 0.92
11 0.89
12 0.81
13 0.74
14 0.71
15 0.71
16 0.68
17 0.67
18 0.66
19 0.62
20 0.59
21 0.54
22 0.52
23 0.45
24 0.46
25 0.44
26 0.43
27 0.49
28 0.58
29 0.64
30 0.6
31 0.62
32 0.58
33 0.54
34 0.56
35 0.53
36 0.53
37 0.53
38 0.56
39 0.5
40 0.45
41 0.41
42 0.32
43 0.32
44 0.27
45 0.3
46 0.34
47 0.35
48 0.36
49 0.37
50 0.4
51 0.39
52 0.38
53 0.41
54 0.38
55 0.42
56 0.42
57 0.41
58 0.37
59 0.34
60 0.31
61 0.25
62 0.23
63 0.18
64 0.24
65 0.25
66 0.24
67 0.24
68 0.22
69 0.19
70 0.16
71 0.16
72 0.1
73 0.11
74 0.11
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.09
83 0.1
84 0.11
85 0.12
86 0.12
87 0.14
88 0.19
89 0.18
90 0.17
91 0.17
92 0.19
93 0.2
94 0.3
95 0.36
96 0.36
97 0.36
98 0.35
99 0.35
100 0.34
101 0.33
102 0.28
103 0.21
104 0.21
105 0.3
106 0.37
107 0.42
108 0.42
109 0.43
110 0.42