Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1D7

Protein Details
Accession I2K1D7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
159-179DPLAKAVRRRLRKRGIMNGVTHydrophilic
NLS Segment(s)
PositionSequence
167-172RRRLRK
Subcellular Location(s) cyto_nucl 8, cyto 7, nucl 5, E.R. 4, extr 3, mito 2, plas 2, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045886  ThiF/MoeB/HesA  
IPR000594  ThiF_NAD_FAD-bd  
IPR035985  Ubiquitin-activating_enz  
Gene Ontology GO:0008641  F:ubiquitin-like modifier activating enzyme activity  
Pfam View protein in Pfam  
PF00899  ThiF  
CDD cd00755  YgdL_like  
Amino Acid Sequences MHFLAMMGXKKIREIFVVVLGAGGVGSNCVATLARSGVTKIRVVDFDQVSLSSLNRHSVATLKDVGTPKVECLRHRILQIAPWCEIEAVDEVFKIENSDRLVAQGNPDYVIDCIDNIDSKVDLLEYCHKKGYKTISSMGASCKSDPTRVNVGDISSTDEDPLAKAVRRRLRKRGIMNGVTCIFSAEKPDPRKXRLLPLPEDEFDKGSVDELSALQKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.18
5 0.16
6 0.14
7 0.12
8 0.09
9 0.08
10 0.04
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.05
18 0.07
19 0.08
20 0.09
21 0.1
22 0.11
23 0.15
24 0.17
25 0.19
26 0.19
27 0.21
28 0.21
29 0.23
30 0.29
31 0.25
32 0.24
33 0.22
34 0.2
35 0.19
36 0.18
37 0.16
38 0.12
39 0.12
40 0.13
41 0.13
42 0.13
43 0.13
44 0.16
45 0.18
46 0.18
47 0.2
48 0.18
49 0.23
50 0.24
51 0.24
52 0.23
53 0.22
54 0.21
55 0.26
56 0.28
57 0.23
58 0.29
59 0.34
60 0.34
61 0.35
62 0.36
63 0.29
64 0.32
65 0.36
66 0.32
67 0.27
68 0.24
69 0.23
70 0.2
71 0.19
72 0.15
73 0.11
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.08
83 0.09
84 0.1
85 0.1
86 0.11
87 0.13
88 0.11
89 0.13
90 0.12
91 0.11
92 0.11
93 0.11
94 0.1
95 0.08
96 0.09
97 0.07
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.04
109 0.06
110 0.15
111 0.18
112 0.19
113 0.24
114 0.24
115 0.24
116 0.29
117 0.35
118 0.32
119 0.32
120 0.34
121 0.35
122 0.35
123 0.36
124 0.35
125 0.31
126 0.26
127 0.23
128 0.25
129 0.21
130 0.24
131 0.24
132 0.27
133 0.3
134 0.3
135 0.31
136 0.27
137 0.27
138 0.24
139 0.23
140 0.22
141 0.16
142 0.16
143 0.14
144 0.13
145 0.13
146 0.12
147 0.14
148 0.11
149 0.12
150 0.15
151 0.24
152 0.32
153 0.43
154 0.5
155 0.58
156 0.66
157 0.73
158 0.78
159 0.8
160 0.81
161 0.78
162 0.72
163 0.68
164 0.59
165 0.51
166 0.42
167 0.33
168 0.24
169 0.17
170 0.21
171 0.2
172 0.27
173 0.35
174 0.44
175 0.48
176 0.52
177 0.58
178 0.57
179 0.61
180 0.62
181 0.61
182 0.59
183 0.6
184 0.57
185 0.56
186 0.52
187 0.44
188 0.36
189 0.31
190 0.24
191 0.19
192 0.16
193 0.12
194 0.12
195 0.11