Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JVN1

Protein Details
Accession I2JVN1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-75IEEEKKDTRASKKRSRTTKVKKBasic
NLS Segment(s)
PositionSequence
58-75KKDTRASKKRSRTTKVKK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGELVLDSDNEDVPLSILLKDRRSVMIKDEYEEDEDSFASIKKENYSVKTEVKIEEEKKDTRASKKRSRTTKVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.13
5 0.16
6 0.18
7 0.19
8 0.21
9 0.24
10 0.26
11 0.26
12 0.26
13 0.32
14 0.3
15 0.3
16 0.31
17 0.28
18 0.27
19 0.27
20 0.22
21 0.13
22 0.12
23 0.11
24 0.09
25 0.08
26 0.06
27 0.07
28 0.08
29 0.09
30 0.13
31 0.16
32 0.19
33 0.24
34 0.27
35 0.29
36 0.31
37 0.32
38 0.29
39 0.3
40 0.34
41 0.31
42 0.34
43 0.36
44 0.35
45 0.36
46 0.42
47 0.44
48 0.47
49 0.54
50 0.58
51 0.63
52 0.72
53 0.79
54 0.82
55 0.86