Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JY35

Protein Details
Accession I2JY35    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
153-194TRSTFPKYEKKDAKEEKKGRTGRGKKEMVRKPRERKERKNESBasic
NLS Segment(s)
PositionSequence
161-193EKKDAKEEKKGRTGRGKKEMVRKPRERKERKNE
Subcellular Location(s) mito 19.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MNWVYRRLRHAFKHNKQAVSDTALITAANLDIYTQLQINRFEAEASGKQKFLPIEKAILTKKISKFLGLFEAKFKAYKYSEDEEMKQPAANFNRWQHAYSILKLLQMNIEMLPAELQPQFKQTLDLINPFLSHVEKLGSAGKTNGSLLDRLITRSTFPKYEKKDAKEEKKGRTGRGKKEMVRKPRERKERKNES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.7
4 0.66
5 0.58
6 0.53
7 0.46
8 0.35
9 0.28
10 0.24
11 0.22
12 0.17
13 0.14
14 0.08
15 0.06
16 0.05
17 0.04
18 0.05
19 0.06
20 0.07
21 0.08
22 0.1
23 0.13
24 0.15
25 0.16
26 0.17
27 0.16
28 0.15
29 0.15
30 0.17
31 0.19
32 0.22
33 0.23
34 0.22
35 0.22
36 0.24
37 0.25
38 0.24
39 0.25
40 0.22
41 0.24
42 0.25
43 0.31
44 0.29
45 0.32
46 0.31
47 0.32
48 0.32
49 0.35
50 0.34
51 0.31
52 0.3
53 0.27
54 0.33
55 0.28
56 0.27
57 0.23
58 0.25
59 0.23
60 0.23
61 0.21
62 0.18
63 0.17
64 0.2
65 0.23
66 0.24
67 0.29
68 0.31
69 0.33
70 0.31
71 0.32
72 0.29
73 0.25
74 0.21
75 0.21
76 0.21
77 0.22
78 0.22
79 0.23
80 0.28
81 0.28
82 0.29
83 0.24
84 0.27
85 0.26
86 0.23
87 0.24
88 0.19
89 0.2
90 0.19
91 0.19
92 0.14
93 0.12
94 0.12
95 0.08
96 0.08
97 0.06
98 0.06
99 0.06
100 0.05
101 0.06
102 0.07
103 0.08
104 0.08
105 0.11
106 0.12
107 0.12
108 0.13
109 0.12
110 0.16
111 0.17
112 0.19
113 0.19
114 0.18
115 0.18
116 0.16
117 0.17
118 0.12
119 0.1
120 0.09
121 0.08
122 0.08
123 0.09
124 0.14
125 0.13
126 0.13
127 0.14
128 0.14
129 0.14
130 0.14
131 0.15
132 0.12
133 0.12
134 0.11
135 0.14
136 0.14
137 0.15
138 0.17
139 0.15
140 0.16
141 0.2
142 0.24
143 0.25
144 0.29
145 0.37
146 0.43
147 0.53
148 0.6
149 0.6
150 0.67
151 0.73
152 0.79
153 0.8
154 0.81
155 0.79
156 0.8
157 0.8
158 0.78
159 0.78
160 0.77
161 0.77
162 0.79
163 0.79
164 0.76
165 0.82
166 0.83
167 0.82
168 0.84
169 0.84
170 0.85
171 0.87
172 0.91
173 0.91
174 0.93