Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JVW1

Protein Details
Accession I2JVW1   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-122LSSGMERRLHRRRRKKKSKHQRTAVSSATHydrophilic
NLS Segment(s)
PositionSequence
101-114RRLHRRRRKKKSKH
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
Amino Acid Sequences MDVCQMLLIVKKLDYEEEVNEIPVDSEYGETYPDGITEPMIQCKSRFXKRYEEQVIQNVEDEVDRLLKLDEQADTSTYEFIDSSMLDDPKVRLALSSGMERRLHRRRRKKKSKHQRTAVSSATQSTTSSITGVSESTEKQNEEDLDSELDKLIGEEESSEEEEEEEEGDEDIGGLTKAKVEEDEGEQEEIVEGAPTETEGER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.22
5 0.22
6 0.21
7 0.2
8 0.18
9 0.16
10 0.13
11 0.12
12 0.07
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.08
24 0.11
25 0.13
26 0.18
27 0.2
28 0.2
29 0.21
30 0.31
31 0.37
32 0.43
33 0.47
34 0.48
35 0.56
36 0.62
37 0.72
38 0.68
39 0.68
40 0.64
41 0.61
42 0.55
43 0.46
44 0.39
45 0.27
46 0.2
47 0.14
48 0.09
49 0.07
50 0.07
51 0.06
52 0.07
53 0.07
54 0.08
55 0.09
56 0.09
57 0.1
58 0.1
59 0.11
60 0.12
61 0.11
62 0.11
63 0.09
64 0.09
65 0.07
66 0.07
67 0.06
68 0.05
69 0.06
70 0.09
71 0.09
72 0.09
73 0.1
74 0.1
75 0.11
76 0.12
77 0.1
78 0.07
79 0.08
80 0.1
81 0.11
82 0.15
83 0.14
84 0.17
85 0.2
86 0.21
87 0.27
88 0.34
89 0.43
90 0.49
91 0.59
92 0.67
93 0.77
94 0.87
95 0.91
96 0.93
97 0.95
98 0.96
99 0.95
100 0.94
101 0.92
102 0.87
103 0.82
104 0.74
105 0.64
106 0.53
107 0.44
108 0.35
109 0.26
110 0.19
111 0.14
112 0.12
113 0.1
114 0.09
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.11
123 0.14
124 0.14
125 0.14
126 0.17
127 0.17
128 0.18
129 0.18
130 0.16
131 0.16
132 0.16
133 0.15
134 0.12
135 0.11
136 0.09
137 0.08
138 0.07
139 0.05
140 0.05
141 0.05
142 0.06
143 0.08
144 0.1
145 0.1
146 0.09
147 0.09
148 0.1
149 0.09
150 0.09
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.07
163 0.08
164 0.08
165 0.09
166 0.11
167 0.14
168 0.17
169 0.23
170 0.23
171 0.23
172 0.22
173 0.22
174 0.2
175 0.17
176 0.13
177 0.08
178 0.06
179 0.05
180 0.05
181 0.05