Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194V8H7

Protein Details
Accession A0A194V8H7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-37FCAVEAQEKKRKKRKLEEVEAHKAPHydrophilic
NLS Segment(s)
PositionSequence
21-35KKRKKRKLEEVEAHK
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVLDNPGPLPHHFCAVEAQEKKRKKRKLEEVEAHKAPAAVVEKRIHDAQRRILKRHKQMQEMASSSVLREQKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.34
4 0.32
5 0.38
6 0.43
7 0.5
8 0.59
9 0.64
10 0.69
11 0.7
12 0.76
13 0.8
14 0.82
15 0.86
16 0.85
17 0.84
18 0.84
19 0.75
20 0.64
21 0.53
22 0.42
23 0.31
24 0.24
25 0.18
26 0.11
27 0.14
28 0.16
29 0.16
30 0.19
31 0.21
32 0.22
33 0.25
34 0.29
35 0.34
36 0.42
37 0.46
38 0.5
39 0.57
40 0.63
41 0.67
42 0.73
43 0.71
44 0.68
45 0.71
46 0.7
47 0.69
48 0.62
49 0.54
50 0.47
51 0.39
52 0.33
53 0.32
54 0.29