Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194V1V2

Protein Details
Accession A0A194V1V2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-32GHTPVASRAKKQRKKKEETRLFRTVLHydrophilic
NLS Segment(s)
PositionSequence
14-22RAKKQRKKK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MSKQTCGHTPVASRAKKQRKKKEETRLFRTVLPSDESLVHLMQFSAEIEVEILCPTDGEDLENHKLSPGDGNDEVTSQDNDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.69
4 0.77
5 0.78
6 0.79
7 0.85
8 0.89
9 0.9
10 0.9
11 0.9
12 0.87
13 0.83
14 0.74
15 0.66
16 0.6
17 0.5
18 0.41
19 0.34
20 0.26
21 0.21
22 0.19
23 0.18
24 0.15
25 0.13
26 0.11
27 0.08
28 0.08
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.04
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.08
47 0.12
48 0.17
49 0.18
50 0.17
51 0.17
52 0.17
53 0.17
54 0.21
55 0.17
56 0.2
57 0.2
58 0.23
59 0.23
60 0.23
61 0.24
62 0.21